SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G19450.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G19450.1
Domain Number 1 Region: 484-850
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.79e-117
Family Motor proteins 0.000000866
Further Details:      
 
Domain Number 2 Region: 14-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-16
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G19450.1
Sequence length 1013
Comment (Brachypodium distachyon)
Sequence
MGSMDGDSEGLQADARRAEVIKWLSALIPEFRLPLDSSDEELRELISDGTALCHIVNTLI
PGVLEGLSDVYASSEQRTGNVKKFLSVVADMGIPGFSVKDLEEGSMSSVVDCLLVLQDNL
NPALVDNLGNVSKTPSRKKWRVLETDGPVVASAAQGKTSSGEDRGNGLPYPKSQQKTPVF
NGEKLREIFQLKRGSYADLPSAKISEMMHSNSLDDAPTQSLLTVVNGILDESIERKKGEI
PHRVVYLLRKVVQEIERRLCIQAEYIRNQNTITRTREEKYRSKIKALEVLVNGTNEENQM
ILNRLKAVKEEKINIEERRKLSEQNVIRLMTEKENAENMVGSLKEEMEEMSRLHQQQLEQ
FEIKTMQMREQLTNRVKEFELFVFQSNRKIEEVETASQLKSQLWNKKENILQNYMNSQQL
YVKDLNLSSRLIRNDMYALQMKWKDEMSNLGSNLKCMVDAAENYHKVLAENQKLFNEMQE
LKGNIRVYCRVRPFLPGQDKKSTTVDYIGESGELLISNPFKQGKDGHRMFKFNKVFSSFA
SQADVYSDIQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPSMSKKDWGVNYRALNDLFD
ISLSRRNVFSYEVGVQMVEIYNEQVRDLLSNNIAQKRLGIWNTSQPNGLVVPDASLHPVK
STSDVLDLMEIGLANRAVGSTALNERSSRSHSILTVHVRGLDVKNGSTSRGCLHLIDLAG
SERVERSEATGDRLKEAQHINKSLSALGDVIFALAQKNAHVPYRNSKLTQVLQSSLGGQA
KTLMFVQINPDVESYSETISTLKFAERVSGVELGAARSNKEGKDIKELLEQVSSLKDTIS
RKDMEIEQLQLVKDKAKSPSFVIDKHGASLPNNFNSNQTSLDILNQQSELSDRLSYAEVN
ANVGHTSPTDIAPTRLDEADYDDNVSEDGSSVRETDYSIGKTNILNSNSDDTTMHRDRVP
LRTAKYTLTKNGQSAMPRSKPRDAVLKTPNHTKAPSNQLAGGSSVQASKRWQK
Download sequence
Identical sequences I1HHH3
15368.BRADI2G19450.1 XP_003566026.1.954 EG:BRADI2G19450.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]