SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G45690.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G45690.1
Domain Number 1 Region: 80-172
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.65e-22
Family Cold shock DNA-binding domain-like 0.00091
Further Details:      
 
Domain Number 2 Region: 167-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.66e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00087
Further Details:      
 
Domain Number 3 Region: 10-69
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 3.87e-18
Family ECR1 N-terminal domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G45690.1
Sequence length 249
Comment (Brachypodium distachyon)
Sequence
MESKKPPPSALVDNHVVPGDVILDLADMTNQTIKLGAGLRQDYDTIQATSAGRLRLSKPN
KYWVESSQKRLPIHVIFFWQYIPSVEDTVLGIVVDTKPDNFLVDIKGPNFAFLPVLSFEG
GTRRNIPKFEIGTLIYARVVKANSIMNPELSCMDASGKAAEFGQLKNGYMFDTSTGLSRM
LLSSPTCPLLEALGKKLSFEIAVGLNGRVWVNAPSPSNVIVVSTAIIRSESYTQIQQKSM
VENLLVKLS
Download sequence
Identical sequences A0A0Q3KDH1
XP_014753752.1.954 15368.BRADI2G45690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]