SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G48070.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G48070.1
Domain Number 1 Region: 143-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G48070.1
Sequence length 393
Comment (Brachypodium distachyon)
Sequence
MASEDEANAAAAAEGEASEGKNWRRKGKHDKDKPWDNDPTIDRWKVERFDPSWNEGGMLE
VTSFSTLFPQYREKYLQEAWPTVKGALKEFGITCELNLVEGSMTVSTTRKTRDPYIIVKA
RDLIKLLSRSVPAPQAIKVLNDEMNCDIVKIGSIIRNKERFVKRRERLLGPNLSTLKAIE
ILTGCYILVQGNTVAAMGSFKGLKQVRRIVEDCIKNIKHPVYHIKELLIKRELAKNPALA
TESWDRFLPNFKKKNVKQKKPNTKEKKPYTPFPPPQQPSKIDLELESGEYFMSDKKKSAK
KWQEKLDKQSEKMEEKKRKREAAFVPPKENSAGPSESAKPTHAKNEIADITKSLKNKAKK
FRNSEAQENVKVDSYIATNEEPQTKKKRKSSSK
Download sequence
Identical sequences I1HQW9
EG:BRADI2G48070.1 15368.BRADI2G48070.1 XP_010232221.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]