SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G58800.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G58800.1
Domain Number 1 Region: 271-310,353-482
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000594
Family Laminin G-like module 0.069
Further Details:      
 
Weak hits

Sequence:  15368.BRADI2G58800.1
Domain Number - Region: 21-58
Classification Level Classification E-value
Superfamily Api92-like 0.0628
Family Api92-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G58800.1
Sequence length 837
Comment (Brachypodium distachyon)
Sequence
MEEDSRDVSDASPTSPWEDGVVEHFDDESPRGEGYIIEDEEMSDVETTADSPVVPPEPST
QPPPPLRRRLAPVVSSEVPEAVVRAVDAVIMGGGVDRLREMVSEENGEVSHFIVDVLMIT
MGGVDGIDEGTGDGTSSSTTPSIMSSSRAAAIAAELLPYLPCGTEPSPRTRMARGLLATL
SACTRNRTMCSASGLLAILLEVAEKLFVGMGQSREWDGTPLVHCIQVLGGHSVSVKGLHS
WLLLVKKALGTLWATQLTLALENSVGCNEAKGPAVTFEFDGESSGLLAPGESRWPFSNGF
GFATWIYVESFSDSRNTATATAAIAAAAASTSGKSSAWAAAAAACTLAGEGTKHMPRLFS
FLTADNDGVEAYFHGQFLVVESGTGKGKKASLHFTYEFKPQCWYFVGLEYASKQGLLGMV
ESELRFYVDDKLHESCPFEFPRILKPLAFCCIGTNPPPTISGLQRRRRQCALFVEMGPIY
IFMEPIGPERMTRLASREGDALPSFSNAAGLPWKATSDHIREVAEDSYALDIETAASLHL
LYHPSLLNGRFCPDASPSGSTGTQRRPAEVVRMVHVSYRVRPAESLWALACGGPMALLPL
TVSNVEMDNLEPILGDLSLSLATASLSVPIFRIISLAIQHPGNKEELCRTHGPELLSLVL
HYLLETLSRLESGKKEILSDEELVAAIVSLCQSQRNDPGLKVQLFSTLLLDLKMWSSCNY
VLQKKLLSSLADMVFAESACMYETNALQMLLDGCRRCYWVTREGDSVDTFTFAGTERPIE
KVNALVNELLVVIELLIGAASSSTMASDDIRCLVGFIVDCPQPNQASGVNTGSPAQY
Download sequence
Identical sequences I1HUL1
EG:BRADI2G58800.1 15368.BRADI2G58800.1 XP_003567402.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]