SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G00340.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G00340.1
Domain Number 1 Region: 91-166
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.71e-33
Family Skp1 dimerisation domain-like 0.0000232
Further Details:      
 
Domain Number 2 Region: 8-68
Classification Level Classification E-value
Superfamily POZ domain 7.33e-23
Family BTB/POZ domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G00340.1
Sequence length 168
Comment (Brachypodium distachyon)
Sequence
MASDGEKKMITLKSSDGEEFEVEETVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVI
EYCNKHVHAADATDAAAANTSAAPAAPTDDLKNWDADFVKVDQATLFDLILAANYLNIKG
LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEIRRENQWAFE
Download sequence
Identical sequences I1HVY8
XP_003573486.1.954 EG:BRADI3G00340.1 15368.BRADI3G00340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]