SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G12540.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G12540.1
Domain Number 1 Region: 30-94
Classification Level Classification E-value
Superfamily SNARE fusion complex 3.4e-16
Family SNARE fusion complex 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G12540.1
Sequence length 122
Comment (Brachypodium distachyon)
Sequence
MNSRRDFRSHRAALFDGIEEGGIRGSAYSSREIHEHENDQAVDNLHERVSILKRLTGDIH
DEVENHNRMLDRMGNDMDTSRGFLSGTVDKFKMVFETKSSRRMATMVASFVAAFLLLYYL
TR
Download sequence
Identical sequences I1I026
15368.BRADI3G12540.1 XP_003573218.1.954 EG:BRADI3G12540.1 EG:BRADI3G12540.2 EG:BRADI3G12540.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]