SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G17630.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G17630.1
Domain Number 1 Region: 386-470
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000906
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 306-371
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000282
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 34-92
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000048
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 4 Region: 563-629
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 5 Region: 139-223
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G17630.1
Sequence length 632
Comment (Brachypodium distachyon)
Sequence
MRHSGKRTSQHRDHDREGRDEKRRPAVHTQENSSNDELVVYRILCPDKVIGSVIGKNGKV
INSIRQQTNAKVKVVDPYPGADKRVILVYCHVHHRDLTHRDIDVDDDDDREPVCAAQNAL
LKVHDAIVEALAINSDSDDEEANILVPASQAASVIGKSGSVIKRLRSISKSSIKVRPKDP
SEVTHSCAMSFDNFVQITGDARAVKKALFAVSAIIYKSPSKEIIPLETSVQELPPSIIIP
SELPVYPASNFYSLSDGAMPSGHPSLPILGAPHHVSRIPEFTVPADAHGRLPIYQSMVPA
IPTYSTPKGSGDLLLRVVCPGDKIGLVIGKGGMTIKSIRKESGANIDVDDAKNDREESII
TVTSTEATDDVKSAAVEAVLLLQAKINDGIEDRMHIRLLVPGNVIGCLIGKGGSIVNDMR
NKSKAIIHISKGSKPRRASSSDELVEVFGEVDKLRDALVQIVLRLREDVLKDSVERQNSD
KDGKRTIAITEPMYSSNFSMPALLPSTRQVSPLSYDQRGEVERGLDVYPRSSSYRYSSLQ
AVDDGYGAHSSYTSKSYGGRRPDIEMIIPASGLSKVIGKRGTNLDNIRKISGADIEIIES
KSSRHDHVAHISGTPEQRQSAENLIRAFIMST
Download sequence
Identical sequences I1I1U1
XP_003573519.1.954 XP_010234444.1.954 XP_010234445.1.954 XP_014756699.1.954 EG:BRADI3G17630.1 15368.BRADI3G17630.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]