SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G27380.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G27380.1
Domain Number 1 Region: 215-270
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.1e-18
Family Skp1 dimerisation domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 59-120
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000667
Family BTB/POZ domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G27380.1
Sequence length 273
Comment (Brachypodium distachyon)
Sequence
MDSIGADEKRKGKAPLLQADDVASAAAAKAAPEEEEEAVSMAEAKRSSSSEVKEREEKPM
LVLLAQDGVEVRISEPAARMSQMLRHMIEDCCAGYRIPTPDVYSDVLERVVHYCEKHGPY
YDPQASERDRHPFPPFPVELTPAVSSIKPVTASRPGTRSSSTSTTPPSSRSRCHKFNWVG
RHCNSIDHDLAQYAREVGVDGIRTGSLPRPVQTGHAANYLNIQDLLDLCTTTLADKMRGK
TPEEIREIFEIENDYTPPQEAEVRRENSWAFED
Download sequence
Identical sequences I1I489
15368.BRADI3G27380.1 EG:BRADI3G27380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]