SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G29870.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G29870.1
Domain Number 1 Region: 154-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 700-767
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000112
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 379-456
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000116
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 4 Region: 45-102
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 291-352
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000449
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Weak hits

Sequence:  15368.BRADI3G29870.1
Domain Number - Region: 459-565
Classification Level Classification E-value
Superfamily beta-Roll 0.000209
Family Serralysin-like metalloprotease, C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G29870.1
Sequence length 790
Comment (Brachypodium distachyon)
Sequence
MDYEKSRRHNPSTSRKRTHFNSDDGNRKRLNSRHDDGPMSSQPIETVYRILCPGKKIGSV
LGRGGHIVKALREETKAKIRVADSIPGAEERVIIIFDYQDQSEQTDEAAQNISNNDGSEN
MKLQCFAQDALLKIHDKISTHEDPHDGAIHEKSETAADVTARILVPGNQVGCLLGKGGSI
IQQLRNDTGAGIRILPSQDLPQCALQSDELVQISGAPSLVRKALYEISTRLHQHPRKENP
PLEEIIDASTQRKRESPPPLPHENLMLPYQHVDRLPPMPLLDPYRSRPSQYPVPEAEEFS
VRILCASELIGPVIGKSGANVRQVEQQTGARILVQELDKDASGERLIVLSSKEIPGDPVS
PAIEALILLHSKVSASSEKRHLITRLVVPSSKVGCILGEGGKVITEMRRRIGAEIRVYSK
ADKPKYLSFDEELVQVAGPPDIARDALTEIASRLRTRTLRDGGSGNNPLPLAPSDGPRGD
IFPSREFTQNGRPANPPYGRPANDSPYRRLAIDQPYGRPASDSLYGMPANDPIYGRPAND
PPYGRPANDPPYGRPANDIPYGRPANKPHDPSSAYPIDYFSKRREYPIGSPFASNAPLSA
SYDRNVASARLPTREMPLSASPGADYMTHRSYRNHMPTDSYSSRGTQELGLSRAGNSNVQ
KLGVARAGNSNAYDYTEAARQMHGREDYQRLAGVTGYSSSSLELMIPNSSLGSVLGAGGV
NLAEIRQISGARMKLLEGHPGSSESIMEIQGMPDQVRAAQSLLQGFIGANSSQSKQPSQS
SRDVHYPRWN
Download sequence
Identical sequences I1I525
XP_010234862.1.954 EG:BRADI3G29870.1 15368.BRADI3G29870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]