SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G33640.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G33640.1
Domain Number 1 Region: 72-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.67e-16
Family Alginate lyase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G33640.1
Sequence length 233
Comment (Brachypodium distachyon)
Sequence
MASLLSSPPLLICLLLAATVATAMTTTPQLDATVGGGGGENPTAGFVKVDLTAGSFKVQS
PYNVPESQRYSYRNDVRQFWVLDTDKPFNTVTHTNPRTEIMIEGHDYSKGVWQFEGYGYV
PSGTSGASVMQIHCEEGAAHATVLMLHVYDGVLRFYDGQVVEKDIYDRWFRLNVVHDTDR
STVTVYVDGQRRYATGVIPSRSYYFKFGVYMQHHDWSPCMESRWTNVTIYTKP
Download sequence
Identical sequences I1I687
EG:BRADI3G33640.1 15368.BRADI3G33640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]