SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G40740.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G40740.1
Domain Number 1 Region: 89-157
Classification Level Classification E-value
Superfamily POZ domain 0.00000165
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G40740.1
Sequence length 157
Comment (Brachypodium distachyon)
Sequence
GDGPSSCKELLWRKNMLQREASQLYAPSWSSMNTPYLCRLQISAPTLAACSITPTGQMWH
SSSTARHSMLTGLCLQPARRSSERSSLDPWPRLQMPSITLHEIAPATSKAMLRSMYTDAL
PREKEIGDSSVEMFQNLLAAADRYALDRMKLTCAQKL
Download sequence
Identical sequences I1I8R2
EG:BRADI3G40740.1 15368.BRADI3G40740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]