SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G40760.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G40760.1
Domain Number 1 Region: 84-160
Classification Level Classification E-value
Superfamily POZ domain 7.85e-17
Family BTB/POZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 22-80
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000899
Family MATH domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G40760.1
Sequence length 169
Comment (Brachypodium distachyon)
Sequence
LWRTSTKTTIFALIKRQCHLGRLLDRQGRQAIHHHCRKVSPRLRCVSWGWPKIVKGDTLE
KDYVSDGHITIVCAVMVIDDSPLPMPRSDIGNHLGRLLDGAAGTDVSFVIDGEIFLAHRA
VLAARSPVLKAELLGSMCDAAMPSITRHDIAPATFKVMLHVHGCLARRG
Download sequence
Identical sequences I1I8R5
15368.BRADI3G40760.1 EG:BRADI3G40760.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]