SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI4G02690.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI4G02690.1
Domain Number 1 Region: 218-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000134
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 119-178
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 398-469
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000789
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI4G02690.1
Sequence length 527
Comment (Brachypodium distachyon)
Sequence
MDIPAEALAVAEHELSEIPNLGEPADIKTEEQANPDSDVPEQYEEELEKPSPDEELKEPK
TEECGNPNDGLQVNMKIENMGHELKEDQAIPSHEAPADVDGGEAEAEQLANVETEDKKWP
GWPGESVFRVLVPVQKVGAVIGRKGEFIKKMCEESRARIKILDGPPGVPERAVMISAKDE
PDALVSPAVDGLLRVHKRITDGLDSETDQPQRGAGPVGPTRLLVPASQAGSLIGKQGATI
KSIQDASKCALRILENVPPVALNDDRVVEIQGEPLDVHKAVELIASHLRKFLVDRSVLPL
FEAQMKVHNVPREQPMPAPQPWGPPPQWSHPPNIPPPGPGYGGNPHFMPPRPQDNYYPPP
DVHPVEKQPQYGISSYGRDAPPSGAPPVSGNQHLPPGSSQITQTLQVPLSYADAVIGAAG
ASISYIRKHSGATISIQEGVPGEMNLEMTGSASQVQTAQQLIKNFMAEASPQAPPPGPAP
PSQPVDNYNSYPPYGGPSYGSPPGGAGPGPHNGGSYGGAHYPPNYGY
Download sequence
Identical sequences I1IGS9
EG:BRADI4G02690.1 XP_003577794.1.954 15368.BRADI4G02690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]