SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI4G06720.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI4G06720.1
Domain Number 1 Region: 90-166
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.22e-19
Family Skp1 dimerisation domain-like 0.00027
Further Details:      
 
Weak hits

Sequence:  15368.BRADI4G06720.1
Domain Number - Region: 11-74
Classification Level Classification E-value
Superfamily POZ domain 0.00589
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI4G06720.1
Sequence length 169
Comment (Brachypodium distachyon)
Sequence
MAAAPSGSRTRMVTLISKGGRHFKMPEAVASVSSRTCKEALDYIEYRGDNTLTIKLLDVD
PRPVSMLVNFCNHMAAAAGDDDAAAAQRMREWEERFLGDDDVDQALLYDLLSAAISIQAD
GLIDLVCKRVAHMIKGKTPQEIRALLGIQDDLTPDQRDEIRTDNSWIDI
Download sequence
Identical sequences C3SA45
15368.BRADI4G06720.1 EG:BRADI4G06720.1 XP_003575494.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]