SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI5G16600.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI5G16600.1
Domain Number 1 Region: 333-640
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-79
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 31-289
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-73
Family Legume lectins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI5G16600.1
Sequence length 681
Comment (Brachypodium distachyon)
Sequence
MCPSRSFLLPILLLALLAGDGSDHAAVLAADQFTYNDFSGANLTLDGLAAVAPNGLLALS
NGTSQAAGHAFHPTPVRMRNNNGAAQSFSVAFVFAIVSNFTVLSDNGMAFVVAPSTRLST
FNAGQYLGILNVTDNGKAENGVFAVELDTMLNPEFQDMNSNHVGVDVNSMRSVQNHSAGY
YDDATGVFSNLSLISRQPMQVWVDYDGATTRLDVTMAPLDVPRPRKPLISAPVNLSAVLV
TDTAYVGFSAATGVIFTRHYVLGWSFALNGPAPPLDTSKLPALPRFGPKPRSKVLEIVLP
IATAAFVLALAIAFFLFVRTRVRYAEVREDWEVEFGPHRFSYKELYKATKGFKNKQLLGT
GGFGRVYKGVLPKPNLEIAVKRVSHDSKQGMKEFIAEVVSLGHLRHRNLVQLLGYCRRQG
ELLLVYDCMPNGSLDKYLYDKTKPVLDWGQRFQIIRGVASGLLYLHEDWEKIVIHRDVKA
SNVLLDGDMNGRLGDFGLARLYDHGLDPQTTHVVGTMGYLAPELVRTGKATPVTDVFAFG
VFVLEVACGRRPLGCAAPDEQNVLLDWVQEHQRRHAALDTVDPRLCGKYDADEARLAIKL
GLMCAHPLPDARPRMRQATQYLEGEVPMPDLVPTFLSYTTLALMQNDGFDSFAMSFPSTV
STSVSPISGDVSAVSGLSGGR
Download sequence
Identical sequences I1IZZ9
XP_003580202.1.954 15368.BRADI5G16600.1 EG:BRADI5G16600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]