SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI5G18290.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI5G18290.1
Domain Number - Region: 182-224
Classification Level Classification E-value
Superfamily HMG-box 0.0105
Family HMG-box 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI5G18290.1
Sequence length 232
Comment (Brachypodium distachyon)
Sequence
MPKKMGVNSKAEAARERRSAEESDRRQRAERAKEEEYWREAEGSKSRAARRKEEEAEKRA
EAAARKAENRRLAEAEAAAASAPSKTDARKAARVAAPAPKVTEAELVRRREEERLRLERE
AEAAKKRAARTAEEEEYERTILVANTNRDDSIIEASSVDEAIVRMSIVDSEAALPADRHP
ERRLKASFKAFEEAELPRLKEEKPGLTLKQYKDMIWKLWKKSPDNPLNKAAE
Download sequence
Identical sequences I1J0K1
XP_010240259.1.954 15368.BRADI5G18290.1 EG:BRADI5G18290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]