SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI5G20720.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI5G20720.1
Domain Number 1 Region: 99-364
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-65
Family Glycosyl hydrolases family 16 0.000000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI5G20720.1
Sequence length 372
Comment (Brachypodium distachyon)
Sequence
MAVDLMAQPCAHLFRHGPFESLPTAGEAEGRVSKGPSLLPARKPPLSGQKRKLCTDKHSE
ANTRGSRCNCSNRRWSLVAAAIMVVASLATSADAAGGSFYEDFEVVWGEDPHPERRVAVI
DGGRLVKLTLDNVSGSGFQSKDAFLFGEFTMQMKLVPGDSAGTVTTFYLSSKDYPMWEGD
GHDEIDFEFLGNVSGEPYLMQTNVYAQGGGRREQRFFLWFDPTADFHNYTILWNPLNIIF
SVDGVPVRVFKNHELQGVPYLSTQAMKARASIWDGESWVTMGGRVKTDWSHAPFVASYGA
YDASTACVSSSSCSAAAAPWMTRRLGPEGQRALAWARDNYMVMDYCDDPWKVFPRGVPAE
CGIDRLAMASLL
Download sequence
Identical sequences I1J1G0
15368.BRADI5G20720.1 XP_003580436.1.954 EG:BRADI5G20726.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]