SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI5G25340.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI5G25340.1
Domain Number 1 Region: 161-236
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 2 Region: 262-293
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000157
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 99-128
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000589
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 35-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000222
Family CCCH zinc finger 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI5G25340.1
Sequence length 298
Comment (Brachypodium distachyon)
Sequence
MDGAAAARKRSRTDTANGGAKRSKETESQQTGLSSKSKPCTKFFSTVGCPFGEGCHFLHF
VPGGYQAVSKTHNLGHAAASAPSRAPVDHGANSHPAPAGKTRMCTKYNTAEGCRFGDKCH
FAHGERELGRTTYESPYAPPMGGRFGSRHEPHPAMMGPTTGSFGASATAKISVDAALAGG
IIGKSGVNTKQICRVTGVKLSIRDHESDPNLKNIELEGNFDQIKQASDMVGELIATISAS
TPLKNPAGAVPPAGRGGPGGRSNYKTKICENFLKGTCTFGDRCHFAHGENEQRKGAAV
Download sequence
Identical sequences I1J334
EG:BRADI5G25340.1 XP_003580767.1.954 15368.BRADI5G25340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]