SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 156889.Mmc1_3719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  156889.Mmc1_3719
Domain Number 1 Region: 8-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.41e-19
Family Thioltransferase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 156889.Mmc1_3719
Sequence length 173
Comment (Magnetococcus MC-1)
Sequence
MRHLLMVTLLSGLWLFPATAQALVNEPFFQDSFLDMAEDAATAAQHQKIYMVFYEQEGCP
YCVQLHQETLPDPQVQAYMKAHFYPVILDIYGAREVTDFQGNATQEKAFARAQRVHFTPT
VIYYDGTGRELFRLAGFWKPMHFKASMRYVQEGHYKNMNFQDLIRKIVQEQQP
Download sequence
Identical sequences A0LE11
156889.Mmc1_3719 gi|117926993|ref|YP_867610.1| WP_011715256.1.83473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]