SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 158879.SA2447 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  158879.SA2447
Domain Number 1 Region: 258-485
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.06e-21
Family Lectin leg-like 0.045
Further Details:      
 
Domain Number 2 Region: 664-749
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000753
Family Dystroglycan, N-terminal domain 0.041
Further Details:      
 
Domain Number 3 Region: 581-662
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000124
Family Dystroglycan, N-terminal domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 158879.SA2447
Sequence length 2271
Comment (Staphylococcus aureus N315)
Sequence
MSKRQKAFHDSLANEKTRVRLYKSGKNWVKSGIKEIEMFKIMGLPFISHSLVSQDNQSIS
KKMTGYGLKTTAVIGGAFTVNMLHDQQAFAASDAPLTSELNTQSETVGNQNSTTIEASTS
TADSTSVTKNSSSVQTSNSDTVSSEKSEKVTSTTNSTSNQQEKLTSTSESTSSKNTTSSS
DTKSVASTSSTEQPINTSTNQSTASNNTSQSTTPSSVNLNKTSTTSTSTAPVKLRTFSRL
AMSTFASAATTTAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITL
GTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAF
GFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLN
VQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATN
LQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNY
TSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPVVLTTT
DNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVV
DTTAPTVTPIGDQSSEVYSPISPIKIATQDNSGNAVTNTVTGLPSGLTFDSTNNTISGTP
TNIGTSTISIVSTDASGNKTTTTFKYEVTRNSMSDSVSTSGSTQQSQSVSTSKADSQSAS
TSTSGSIVVSTSASTSKSTSVSLSDSVSASKSLSTSESNSVSSSTSTSLVNSQSVSSSMS
GSVSKSTSLSDSISNSNSTEKSESLSTSTSDSLRTSTSLSDSLSMSTSGSLSKSQSLSTS
ISGSSSTSASLSDSTSNAISTSTSLSESASTSDSISISNSIANSQSASTSKSDSQSTSIS
LSTSDSKSMSTSESLSDSTSTSGSVSGSLSIAASQSVSTSTSDSMSTSEIVSDSISTSGS
LSASDSKSMSVSSSMSTSQSGSTSESLSDSQSTSDSDSKSLSLSTSQSGSTSTSTSTSAS
VRTSESQSTSGSMSASQSDSMSISTSFSDSTSDSKSASTASSESISQSASTSTSGSVSTS
TSLSTSNSERTSTSVSDSTSLSTSESDSISESTSTSDSISEAISASESTSISLSESNSTS
DSESQSASAFLSESLSESTSESTSESVSSSTSESTSLSDSTSESGSTSTSLSNSTSGSAS
ISTSTSISESTSTFKSESVSTSLSMSTSTSLSNSTSLSTSLSDSTSDSKSDSLSTSMSTS
DSISTSKSDSISTSTSLSGSTSESESDSTSSSESKSDSTSMSISMSQSTSGSTSTSTSTS
LSDSTSTSLSLSASMNQSGVDSNSASQSASNSTSTSTSESDSQSTSTYTSQSTSQSESTS
TSTSLSDSTSISKSTSQSGSTSTSASLSGSESESDSQSISTSASESTSESASTSLSDSTS
TSNSGSASTSTSLSNSASASESDSSSTSLSDSTSASMQSSESDSQSTSASLSDSLSTSTS
NRMSTIASLSTSVSTSESGSTSESTSESDSTSTSLSDSQSTSRSTSASGSASTSTSTSDS
RSTSASTSTSMRTSTSDSQSMSLSTSTSTSMSDSTSLSDSVSDSTSDSTSASTSGSMSVS
ISLSDSTSTSTSASEVMSASISDSQSMSESVNDSESVSESNSESDSKSMSGSTSVSDSGS
LSVSTSLRKSESVSESSSLSGSQSMSDSVSTSDSSSLSVSTSLRSSESVSESDSLSDSKS
TSGSTSTSTSGSLSTSTSLSGSESVSESTSLSDSISMSDSTSTSDSDSLSGSISLSGSTS
LSTSDSLSDSKSLSSSQSMSGSESTSTSVSDSQSSSTSNSQFDSMSISASESDSMSTSDS
SNISGSNSTSTSLSTSDSMSGSVSVSTSTSLSDSISGSTSVSDSSSTSTSTSLSDSMSQS
QSTSTSASGSLSTSISTSMSMSASTSSSQSTSVSTSLSTSDSISDSTSISISGSQSTVES
ESTSDSTSISDSESLSTSDSDSTSTSTSDSTSGSTSTSISESLSTSGSGSTSVSDSTSMS
ESDSTSVSMSQDKSDSTSISDSESVSTSTSTSLSTSDSTSTSESLSTSMSGSQSISDSTS
TSMSGSTSTSESNSMHPSDSMSMHHTHSTSTSRLSSEATTSTSESQSTLSATSEVTKHNG
TPAQSEKRLPDTGDSIKQNGLLGGVMTLLVGLGLMKRKKKKDENDQDDSQA
Download sequence
Identical sequences A0A2C6NEA6 Q7A362 Q99QY4
gi|269204292|ref|YP_003283561.1| gi|470223687|ref|YP_007622244.1| gi|15928240|ref|NP_375773.1| gi|148269087|ref|YP_001248030.1| gi|470198129|ref|YP_007584530.1| 158878.SAV2654 158879.SA2447 359786.SaurJH9_2678 359787.SaurJH1_2734 418127.SAHV_2638 681288.SAAV_2725 gi|150395168|ref|YP_001317843.1| gi|470219865|ref|YP_007620259.1| gi|470225654|ref|YP_007624233.1| gi|15925644|ref|NP_373178.1| WP_000044547.1.10014 WP_000044547.1.10032 WP_000044547.1.100366 WP_000044547.1.100399 WP_000044547.1.10046 WP_000044547.1.100464 WP_000044547.1.10050 WP_000044547.1.100535 WP_000044547.1.100582 WP_000044547.1.100596 WP_000044547.1.100693 WP_000044547.1.100699 WP_000044547.1.100704 WP_000044547.1.100719 WP_000044547.1.100823 WP_000044547.1.100860 WP_000044547.1.100888 WP_000044547.1.10097 WP_000044547.1.101002 WP_000044547.1.101068 WP_000044547.1.101071 WP_000044547.1.101072 WP_000044547.1.101103 WP_000044547.1.10111 WP_000044547.1.101160 WP_000044547.1.101192 WP_000044547.1.101379 WP_000044547.1.101440 WP_000044547.1.101441 WP_000044547.1.10148 WP_000044547.1.10165 WP_000044547.1.101661 WP_000044547.1.101691 WP_000044547.1.101704 WP_000044547.1.101728 WP_000044547.1.101745 WP_000044547.1.101820 WP_000044547.1.101825 WP_000044547.1.101852 WP_000044547.1.101902 WP_000044547.1.101906 WP_000044547.1.102096 WP_000044547.1.102123 WP_000044547.1.102130 WP_000044547.1.10238 WP_000044547.1.1025 WP_000044547.1.10274 WP_000044547.1.1031 WP_000044547.1.10343 WP_000044547.1.1043 WP_000044547.1.10436 WP_000044547.1.10481 WP_000044547.1.10624 WP_000044547.1.10749 WP_000044547.1.10751 WP_000044547.1.1077 WP_000044547.1.10823 WP_000044547.1.10858 WP_000044547.1.10919 WP_000044547.1.10942 WP_000044547.1.10976 WP_000044547.1.10979 WP_000044547.1.11001 WP_000044547.1.11069 WP_000044547.1.11073 WP_000044547.1.11083 WP_000044547.1.1115 WP_000044547.1.11220 WP_000044547.1.11286 WP_000044547.1.11333 WP_000044547.1.11378 WP_000044547.1.11403 WP_000044547.1.11447 WP_000044547.1.11451 WP_000044547.1.1147 WP_000044547.1.11504 WP_000044547.1.11513 WP_000044547.1.11611 WP_000044547.1.11640 WP_000044547.1.11646 WP_000044547.1.1171 WP_000044547.1.11768 WP_000044547.1.11794 WP_000044547.1.11884 WP_000044547.1.11903 WP_000044547.1.12019 WP_000044547.1.12152 WP_000044547.1.12170 WP_000044547.1.12175 WP_000044547.1.12234 WP_000044547.1.12256 WP_000044547.1.12437 WP_000044547.1.12598 WP_000044547.1.12608 WP_000044547.1.12733 WP_000044547.1.12737 WP_000044547.1.12770 WP_000044547.1.12780 WP_000044547.1.12788 WP_000044547.1.12829 WP_000044547.1.12904 WP_000044547.1.13062 WP_000044547.1.13154 WP_000044547.1.13243 WP_000044547.1.13250 WP_000044547.1.13355 WP_000044547.1.13379 WP_000044547.1.13405 WP_000044547.1.13448 WP_000044547.1.13514 WP_000044547.1.13612 WP_000044547.1.13665 WP_000044547.1.13668 WP_000044547.1.13670 WP_000044547.1.13879 WP_000044547.1.13897 WP_000044547.1.13933 WP_000044547.1.14097 WP_000044547.1.14143 WP_000044547.1.14163 WP_000044547.1.1420 WP_000044547.1.14201 WP_000044547.1.1425 WP_000044547.1.1429 WP_000044547.1.14305 WP_000044547.1.14342 WP_000044547.1.14358 WP_000044547.1.14397 WP_000044547.1.14412 WP_000044547.1.14535 WP_000044547.1.14596 WP_000044547.1.14639 WP_000044547.1.14696 WP_000044547.1.14729 WP_000044547.1.14734 WP_000044547.1.14774 WP_000044547.1.14874 WP_000044547.1.14967 WP_000044547.1.14970 WP_000044547.1.15015 WP_000044547.1.15029 WP_000044547.1.15173 WP_000044547.1.15185 WP_000044547.1.1520 WP_000044547.1.1525 WP_000044547.1.15268 WP_000044547.1.15269 WP_000044547.1.15294 WP_000044547.1.15296 WP_000044547.1.15421 WP_000044547.1.15533 WP_000044547.1.15544 WP_000044547.1.15546 WP_000044547.1.1558 WP_000044547.1.15722 WP_000044547.1.15785 WP_000044547.1.15812 WP_000044547.1.159 WP_000044547.1.15920 WP_000044547.1.16018 WP_000044547.1.16068 WP_000044547.1.16096 WP_000044547.1.16140 WP_000044547.1.16195 WP_000044547.1.16203 WP_000044547.1.16223 WP_000044547.1.1623 WP_000044547.1.16251 WP_000044547.1.16276 WP_000044547.1.16311 WP_000044547.1.16395 WP_000044547.1.16407 WP_000044547.1.16589 WP_000044547.1.16639 WP_000044547.1.1665 WP_000044547.1.16653 WP_000044547.1.16815 WP_000044547.1.16824 WP_000044547.1.16880 WP_000044547.1.16925 WP_000044547.1.16969 WP_000044547.1.17046 WP_000044547.1.17122 WP_000044547.1.17132 WP_000044547.1.17139 WP_000044547.1.17180 WP_000044547.1.17309 WP_000044547.1.17327 WP_000044547.1.1736 WP_000044547.1.1741 WP_000044547.1.17454 WP_000044547.1.17529 WP_000044547.1.17531 WP_000044547.1.1756 WP_000044547.1.17590 WP_000044547.1.17643 WP_000044547.1.17671 WP_000044547.1.17717 WP_000044547.1.17718 WP_000044547.1.17725 WP_000044547.1.17737 WP_000044547.1.17796 WP_000044547.1.17818 WP_000044547.1.17832 WP_000044547.1.17847 WP_000044547.1.17853 WP_000044547.1.17909 WP_000044547.1.17987 WP_000044547.1.18011 WP_000044547.1.18069 WP_000044547.1.18080 WP_000044547.1.18140 WP_000044547.1.18153 WP_000044547.1.18203 WP_000044547.1.18248 WP_000044547.1.18261 WP_000044547.1.18288 WP_000044547.1.1829 WP_000044547.1.18301 WP_000044547.1.18309 WP_000044547.1.18310 WP_000044547.1.18429 WP_000044547.1.1847 WP_000044547.1.18487 WP_000044547.1.18506 WP_000044547.1.18507 WP_000044547.1.18539 WP_000044547.1.18570 WP_000044547.1.18591 WP_000044547.1.18679 WP_000044547.1.18777 WP_000044547.1.18792 WP_000044547.1.18818 WP_000044547.1.18819 WP_000044547.1.18834 WP_000044547.1.18882 WP_000044547.1.1892 WP_000044547.1.18965 WP_000044547.1.19082 WP_000044547.1.1911 WP_000044547.1.19301 WP_000044547.1.19322 WP_000044547.1.19555 WP_000044547.1.19577 WP_000044547.1.1964 WP_000044547.1.19701 WP_000044547.1.19725 WP_000044547.1.1974 WP_000044547.1.19748 WP_000044547.1.19816 WP_000044547.1.19848 WP_000044547.1.19891 WP_000044547.1.19912 WP_000044547.1.19921 WP_000044547.1.19981 WP_000044547.1.20049 WP_000044547.1.20052 WP_000044547.1.2007 WP_000044547.1.20078 WP_000044547.1.20100 WP_000044547.1.20156 WP_000044547.1.20161 WP_000044547.1.20167 WP_000044547.1.20191 WP_000044547.1.20245 WP_000044547.1.20324 WP_000044547.1.20340 WP_000044547.1.20399 WP_000044547.1.20411 WP_000044547.1.20447 WP_000044547.1.20479 WP_000044547.1.20487 WP_000044547.1.20579 WP_000044547.1.20585 WP_000044547.1.20611 WP_000044547.1.20619 WP_000044547.1.20620 WP_000044547.1.20796 WP_000044547.1.20821 WP_000044547.1.20867 WP_000044547.1.20878 WP_000044547.1.20935 WP_000044547.1.20939 WP_000044547.1.20945 WP_000044547.1.20971 WP_000044547.1.21056 WP_000044547.1.21066 WP_000044547.1.21078 WP_000044547.1.21109 WP_000044547.1.21111 WP_000044547.1.21183 WP_000044547.1.2119 WP_000044547.1.21257 WP_000044547.1.21272 WP_000044547.1.21339 WP_000044547.1.2135 WP_000044547.1.21359 WP_000044547.1.21379 WP_000044547.1.21393 WP_000044547.1.21412 WP_000044547.1.21464 WP_000044547.1.21480 WP_000044547.1.21500 WP_000044547.1.21514 WP_000044547.1.21572 WP_000044547.1.2159 WP_000044547.1.2160 WP_000044547.1.21636 WP_000044547.1.21724 WP_000044547.1.21746 WP_000044547.1.21763 WP_000044547.1.21787 WP_000044547.1.21830 WP_000044547.1.21988 WP_000044547.1.22027 WP_000044547.1.22082 WP_000044547.1.22177 WP_000044547.1.22197 WP_000044547.1.22227 WP_000044547.1.22302 WP_000044547.1.22400 WP_000044547.1.22493 WP_000044547.1.22533 WP_000044547.1.22559 WP_000044547.1.22650 WP_000044547.1.22702 WP_000044547.1.22709 WP_000044547.1.22738 WP_000044547.1.22789 WP_000044547.1.22790 WP_000044547.1.22803 WP_000044547.1.22869 WP_000044547.1.22890 WP_000044547.1.23008 WP_000044547.1.23103 WP_000044547.1.23130 WP_000044547.1.23132 WP_000044547.1.23133 WP_000044547.1.23185 WP_000044547.1.23244 WP_000044547.1.2327 WP_000044547.1.23275 WP_000044547.1.23288 WP_000044547.1.23413 WP_000044547.1.23449 WP_000044547.1.23531 WP_000044547.1.23572 WP_000044547.1.23644 WP_000044547.1.23690 WP_000044547.1.23796 WP_000044547.1.23809 WP_000044547.1.23842 WP_000044547.1.2389 WP_000044547.1.23900 WP_000044547.1.23956 WP_000044547.1.24000 WP_000044547.1.24207 WP_000044547.1.24263 WP_000044547.1.24277 WP_000044547.1.24343 WP_000044547.1.24416 WP_000044547.1.24469 WP_000044547.1.2450 WP_000044547.1.24589 WP_000044547.1.24596 WP_000044547.1.24631 WP_000044547.1.24679 WP_000044547.1.24823 WP_000044547.1.24855 WP_000044547.1.25012 WP_000044547.1.2506 WP_000044547.1.25070 WP_000044547.1.25092 WP_000044547.1.25098 WP_000044547.1.25115 WP_000044547.1.25167 WP_000044547.1.25209 WP_000044547.1.25287 WP_000044547.1.25489 WP_000044547.1.2552 WP_000044547.1.25557 WP_000044547.1.25595 WP_000044547.1.25623 WP_000044547.1.25758 WP_000044547.1.25772 WP_000044547.1.25779 WP_000044547.1.25802 WP_000044547.1.25840 WP_000044547.1.25856 WP_000044547.1.25857 WP_000044547.1.2590 WP_000044547.1.25910 WP_000044547.1.25930 WP_000044547.1.26039 WP_000044547.1.26086 WP_000044547.1.26106 WP_000044547.1.26169 WP_000044547.1.2621 WP_000044547.1.26255 WP_000044547.1.26276 WP_000044547.1.26290 WP_000044547.1.26314 WP_000044547.1.26318 WP_000044547.1.26340 WP_000044547.1.26345 WP_000044547.1.26359 WP_000044547.1.26364 WP_000044547.1.26404 WP_000044547.1.2643 WP_000044547.1.26506 WP_000044547.1.26662 WP_000044547.1.26677 WP_000044547.1.26692 WP_000044547.1.2673 WP_000044547.1.26751 WP_000044547.1.26804 WP_000044547.1.2684 WP_000044547.1.26865 WP_000044547.1.26884 WP_000044547.1.2689 WP_000044547.1.26905 WP_000044547.1.26944 WP_000044547.1.27053 WP_000044547.1.27083 WP_000044547.1.27166 WP_000044547.1.27170 WP_000044547.1.27182 WP_000044547.1.2719 WP_000044547.1.27262 WP_000044547.1.27294 WP_000044547.1.27323 WP_000044547.1.27379 WP_000044547.1.27387 WP_000044547.1.27447 WP_000044547.1.27456 WP_000044547.1.2753 WP_000044547.1.27539 WP_000044547.1.27590 WP_000044547.1.27628 WP_000044547.1.27689 WP_000044547.1.27739 WP_000044547.1.27744 WP_000044547.1.27765 WP_000044547.1.27793 WP_000044547.1.27830 WP_000044547.1.2795 WP_000044547.1.28091 WP_000044547.1.28105 WP_000044547.1.28173 WP_000044547.1.28213 WP_000044547.1.28226 WP_000044547.1.28230 WP_000044547.1.28253 WP_000044547.1.28274 WP_000044547.1.28315 WP_000044547.1.28319 WP_000044547.1.28347 WP_000044547.1.28400 WP_000044547.1.28430 WP_000044547.1.2852 WP_000044547.1.28578 WP_000044547.1.28580 WP_000044547.1.28720 WP_000044547.1.28763 WP_000044547.1.28784 WP_000044547.1.28785 WP_000044547.1.28848 WP_000044547.1.28871 WP_000044547.1.28981 WP_000044547.1.29060 WP_000044547.1.29112 WP_000044547.1.29155 WP_000044547.1.29187 WP_000044547.1.29226 WP_000044547.1.29242 WP_000044547.1.29263 WP_000044547.1.29276 WP_000044547.1.29366 WP_000044547.1.29395 WP_000044547.1.29420 WP_000044547.1.2957 WP_000044547.1.2972 WP_000044547.1.29736 WP_000044547.1.29744 WP_000044547.1.29788 WP_000044547.1.2981 WP_000044547.1.29862 WP_000044547.1.29902 WP_000044547.1.29905 WP_000044547.1.29918 WP_000044547.1.29981 WP_000044547.1.30051 WP_000044547.1.30095 WP_000044547.1.30100 WP_000044547.1.30197 WP_000044547.1.30209 WP_000044547.1.30268 WP_000044547.1.30307 WP_000044547.1.30328 WP_000044547.1.30364 WP_000044547.1.30508 WP_000044547.1.30560 WP_000044547.1.30645 WP_000044547.1.30646 WP_000044547.1.30702 WP_000044547.1.30726 WP_000044547.1.30763 WP_000044547.1.3077 WP_000044547.1.30854 WP_000044547.1.31005 WP_000044547.1.31022 WP_000044547.1.31048 WP_000044547.1.31206 WP_000044547.1.31315 WP_000044547.1.31339 WP_000044547.1.31355 WP_000044547.1.31437 WP_000044547.1.31442 WP_000044547.1.31468 WP_000044547.1.31529 WP_000044547.1.31539 WP_000044547.1.31642 WP_000044547.1.31647 WP_000044547.1.31653 WP_000044547.1.31753 WP_000044547.1.31827 WP_000044547.1.31828 WP_000044547.1.31842 WP_000044547.1.31892 WP_000044547.1.31931 WP_000044547.1.31997 WP_000044547.1.32029 WP_000044547.1.32067 WP_000044547.1.32160 WP_000044547.1.32207 WP_000044547.1.3229 WP_000044547.1.32339 WP_000044547.1.32474 WP_000044547.1.32481 WP_000044547.1.32483 WP_000044547.1.32514 WP_000044547.1.32565 WP_000044547.1.32634 WP_000044547.1.32645 WP_000044547.1.32746 WP_000044547.1.32764 WP_000044547.1.32770 WP_000044547.1.32800 WP_000044547.1.32928 WP_000044547.1.32939 WP_000044547.1.32954 WP_000044547.1.33110 WP_000044547.1.33123 WP_000044547.1.33138 WP_000044547.1.33212 WP_000044547.1.33250 WP_000044547.1.33266 WP_000044547.1.33335 WP_000044547.1.33357 WP_000044547.1.33416 WP_000044547.1.33468 WP_000044547.1.3347 WP_000044547.1.33507 WP_000044547.1.33594 WP_000044547.1.3363 WP_000044547.1.33654 WP_000044547.1.33692 WP_000044547.1.33695 WP_000044547.1.33718 WP_000044547.1.33743 WP_000044547.1.33792 WP_000044547.1.33804 WP_000044547.1.33968 WP_000044547.1.33971 WP_000044547.1.34026 WP_000044547.1.34051 WP_000044547.1.34062 WP_000044547.1.34100 WP_000044547.1.34132 WP_000044547.1.34182 WP_000044547.1.34209 WP_000044547.1.34244 WP_000044547.1.34251 WP_000044547.1.34381 WP_000044547.1.34403 WP_000044547.1.34410 WP_000044547.1.34482 WP_000044547.1.34492 WP_000044547.1.34502 WP_000044547.1.34510 WP_000044547.1.34526 WP_000044547.1.3461 WP_000044547.1.34737 WP_000044547.1.34818 WP_000044547.1.34890 WP_000044547.1.34918 WP_000044547.1.34998 WP_000044547.1.35062 WP_000044547.1.35089 WP_000044547.1.35097 WP_000044547.1.35110 WP_000044547.1.35233 WP_000044547.1.35276 WP_000044547.1.35285 WP_000044547.1.35297 WP_000044547.1.35334 WP_000044547.1.35342 WP_000044547.1.354 WP_000044547.1.35415 WP_000044547.1.35498 WP_000044547.1.35525 WP_000044547.1.35580 WP_000044547.1.35615 WP_000044547.1.35623 WP_000044547.1.3569 WP_000044547.1.35801 WP_000044547.1.35900 WP_000044547.1.35928 WP_000044547.1.35950 WP_000044547.1.36004 WP_000044547.1.36082 WP_000044547.1.36119 WP_000044547.1.36141 WP_000044547.1.36176 WP_000044547.1.36187 WP_000044547.1.36264 WP_000044547.1.36278 WP_000044547.1.36282 WP_000044547.1.36307 WP_000044547.1.36344 WP_000044547.1.36535 WP_000044547.1.3655 WP_000044547.1.36570 WP_000044547.1.36600 WP_000044547.1.36615 WP_000044547.1.36646 WP_000044547.1.3666 WP_000044547.1.36697 WP_000044547.1.36796 WP_000044547.1.36822 WP_000044547.1.3685 WP_000044547.1.36858 WP_000044547.1.3687 WP_000044547.1.36955 WP_000044547.1.36979 WP_000044547.1.36980 WP_000044547.1.36997 WP_000044547.1.37002 WP_000044547.1.37016 WP_000044547.1.3703 WP_000044547.1.37080 WP_000044547.1.37134 WP_000044547.1.37220 WP_000044547.1.37424 WP_000044547.1.37602 WP_000044547.1.37605 WP_000044547.1.37606 WP_000044547.1.37621 WP_000044547.1.37624 WP_000044547.1.37781 WP_000044547.1.37815 WP_000044547.1.37828 WP_000044547.1.37953 WP_000044547.1.37987 WP_000044547.1.38057 WP_000044547.1.38082 WP_000044547.1.3809 WP_000044547.1.38160 WP_000044547.1.38177 WP_000044547.1.3820 WP_000044547.1.38230 WP_000044547.1.38232 WP_000044547.1.38309 WP_000044547.1.38339 WP_000044547.1.38383 WP_000044547.1.3842 WP_000044547.1.38437 WP_000044547.1.38453 WP_000044547.1.38493 WP_000044547.1.38546 WP_000044547.1.38607 WP_000044547.1.38612 WP_000044547.1.3867 WP_000044547.1.38674 WP_000044547.1.38721 WP_000044547.1.38760 WP_000044547.1.38823 WP_000044547.1.38841 WP_000044547.1.38858 WP_000044547.1.38926 WP_000044547.1.38931 WP_000044547.1.38941 WP_000044547.1.38972 WP_000044547.1.38989 WP_000044547.1.390 WP_000044547.1.39012 WP_000044547.1.39043 WP_000044547.1.39053 WP_000044547.1.3906 WP_000044547.1.39203 WP_000044547.1.39206 WP_000044547.1.39217 WP_000044547.1.3926 WP_000044547.1.39290 WP_000044547.1.39332 WP_000044547.1.39333 WP_000044547.1.39397 WP_000044547.1.39486 WP_000044547.1.39506 WP_000044547.1.39550 WP_000044547.1.39645 WP_000044547.1.39687 WP_000044547.1.39689 WP_000044547.1.39697 WP_000044547.1.39711 WP_000044547.1.39767 WP_000044547.1.39789 WP_000044547.1.39832 WP_000044547.1.39856 WP_000044547.1.39869 WP_000044547.1.40014 WP_000044547.1.40043 WP_000044547.1.40099 WP_000044547.1.40120 WP_000044547.1.40137 WP_000044547.1.40164 WP_000044547.1.4019 WP_000044547.1.40320 WP_000044547.1.40330 WP_000044547.1.40368 WP_000044547.1.40406 WP_000044547.1.40474 WP_000044547.1.40481 WP_000044547.1.40531 WP_000044547.1.40532 WP_000044547.1.4056 WP_000044547.1.40588 WP_000044547.1.40655 WP_000044547.1.40658 WP_000044547.1.40659 WP_000044547.1.40760 WP_000044547.1.40797 WP_000044547.1.40816 WP_000044547.1.41094 WP_000044547.1.41119 WP_000044547.1.41129 WP_000044547.1.4115 WP_000044547.1.41178 WP_000044547.1.41208 WP_000044547.1.41241 WP_000044547.1.4129 WP_000044547.1.41426 WP_000044547.1.41433 WP_000044547.1.41499 WP_000044547.1.41558 WP_000044547.1.41582 WP_000044547.1.41674 WP_000044547.1.41839 WP_000044547.1.4188 WP_000044547.1.41898 WP_000044547.1.41935 WP_000044547.1.41943 WP_000044547.1.41989 WP_000044547.1.420 WP_000044547.1.42015 WP_000044547.1.42017 WP_000044547.1.42028 WP_000044547.1.42125 WP_000044547.1.42198 WP_000044547.1.42269 WP_000044547.1.42305 WP_000044547.1.42355 WP_000044547.1.42403 WP_000044547.1.42436 WP_000044547.1.42459 WP_000044547.1.42481 WP_000044547.1.42510 WP_000044547.1.42593 WP_000044547.1.426 WP_000044547.1.42640 WP_000044547.1.42668 WP_000044547.1.42674 WP_000044547.1.42737 WP_000044547.1.42786 WP_000044547.1.42837 WP_000044547.1.43014 WP_000044547.1.43047 WP_000044547.1.43072 WP_000044547.1.43131 WP_000044547.1.43143 WP_000044547.1.43147 WP_000044547.1.43165 WP_000044547.1.43202 WP_000044547.1.4325 WP_000044547.1.43263 WP_000044547.1.4327 WP_000044547.1.43274 WP_000044547.1.43341 WP_000044547.1.43349 WP_000044547.1.43369 WP_000044547.1.4337 WP_000044547.1.43406 WP_000044547.1.4341 WP_000044547.1.43460 WP_000044547.1.43617 WP_000044547.1.43618 WP_000044547.1.43627 WP_000044547.1.43659 WP_000044547.1.43703 WP_000044547.1.4372 WP_000044547.1.43752 WP_000044547.1.43788 WP_000044547.1.43819 WP_000044547.1.43827 WP_000044547.1.43904 WP_000044547.1.43915 WP_000044547.1.44119 WP_000044547.1.44153 WP_000044547.1.44181 WP_000044547.1.44195 WP_000044547.1.44265 WP_000044547.1.44302 WP_000044547.1.44388 WP_000044547.1.44396 WP_000044547.1.44405 WP_000044547.1.44544 WP_000044547.1.44579 WP_000044547.1.44588 WP_000044547.1.44631 WP_000044547.1.44732 WP_000044547.1.44755 WP_000044547.1.44785 WP_000044547.1.44788 WP_000044547.1.44796 WP_000044547.1.44881 WP_000044547.1.44914 WP_000044547.1.44955 WP_000044547.1.44969 WP_000044547.1.45033 WP_000044547.1.45035 WP_000044547.1.45099 WP_000044547.1.4513 WP_000044547.1.45164 WP_000044547.1.45170 WP_000044547.1.45272 WP_000044547.1.45290 WP_000044547.1.45297 WP_000044547.1.453 WP_000044547.1.45364 WP_000044547.1.45439 WP_000044547.1.45560 WP_000044547.1.45577 WP_000044547.1.45670 WP_000044547.1.45768 WP_000044547.1.45897 WP_000044547.1.45954 WP_000044547.1.4598 WP_000044547.1.46003 WP_000044547.1.46005 WP_000044547.1.46055 WP_000044547.1.46087 WP_000044547.1.46208 WP_000044547.1.46222 WP_000044547.1.46228 WP_000044547.1.46276 WP_000044547.1.46330 WP_000044547.1.46362 WP_000044547.1.46368 WP_000044547.1.46401 WP_000044547.1.46422 WP_000044547.1.46465 WP_000044547.1.46543 WP_000044547.1.4662 WP_000044547.1.46660 WP_000044547.1.46664 WP_000044547.1.46702 WP_000044547.1.46752 WP_000044547.1.46765 WP_000044547.1.46852 WP_000044547.1.46925 WP_000044547.1.46983 WP_000044547.1.47128 WP_000044547.1.47153 WP_000044547.1.47187 WP_000044547.1.47211 WP_000044547.1.47258 WP_000044547.1.47269 WP_000044547.1.47279 WP_000044547.1.47290 WP_000044547.1.47306 WP_000044547.1.47328 WP_000044547.1.47381 WP_000044547.1.47406 WP_000044547.1.47439 WP_000044547.1.47560 WP_000044547.1.47618 WP_000044547.1.4767 WP_000044547.1.477 WP_000044547.1.47733 WP_000044547.1.47763 WP_000044547.1.47782 WP_000044547.1.47836 WP_000044547.1.47859 WP_000044547.1.47872 WP_000044547.1.47873 WP_000044547.1.48011 WP_000044547.1.48030 WP_000044547.1.4805 WP_000044547.1.48149 WP_000044547.1.48169 WP_000044547.1.48227 WP_000044547.1.48250 WP_000044547.1.48284 WP_000044547.1.48293 WP_000044547.1.48307 WP_000044547.1.48322 WP_000044547.1.48391 WP_000044547.1.48394 WP_000044547.1.48463 WP_000044547.1.48563 WP_000044547.1.48577 WP_000044547.1.48634 WP_000044547.1.48656 WP_000044547.1.4868 WP_000044547.1.48705 WP_000044547.1.48823 WP_000044547.1.48833 WP_000044547.1.48835 WP_000044547.1.4886 WP_000044547.1.48936 WP_000044547.1.48941 WP_000044547.1.48945 WP_000044547.1.48951 WP_000044547.1.48968 WP_000044547.1.48982 WP_000044547.1.48993 WP_000044547.1.4901 WP_000044547.1.4905 WP_000044547.1.49129 WP_000044547.1.49159 WP_000044547.1.4916 WP_000044547.1.49161 WP_000044547.1.4917 WP_000044547.1.4918 WP_000044547.1.49207 WP_000044547.1.49248 WP_000044547.1.49327 WP_000044547.1.49398 WP_000044547.1.4950 WP_000044547.1.4962 WP_000044547.1.49653 WP_000044547.1.49669 WP_000044547.1.49730 WP_000044547.1.49742 WP_000044547.1.49800 WP_000044547.1.49860 WP_000044547.1.49871 WP_000044547.1.4989 WP_000044547.1.49894 WP_000044547.1.49907 WP_000044547.1.4994 WP_000044547.1.49982 WP_000044547.1.50013 WP_000044547.1.50038 WP_000044547.1.50061 WP_000044547.1.5013 WP_000044547.1.50138 WP_000044547.1.50217 WP_000044547.1.50219 WP_000044547.1.50261 WP_000044547.1.50314 WP_000044547.1.50425 WP_000044547.1.50430 WP_000044547.1.50536 WP_000044547.1.50555 WP_000044547.1.50578 WP_000044547.1.50595 WP_000044547.1.50660 WP_000044547.1.50768 WP_000044547.1.50799 WP_000044547.1.50896 WP_000044547.1.50937 WP_000044547.1.50962 WP_000044547.1.5110 WP_000044547.1.5111 WP_000044547.1.51152 WP_000044547.1.51236 WP_000044547.1.51250 WP_000044547.1.51282 WP_000044547.1.51295 WP_000044547.1.51306 WP_000044547.1.51310 WP_000044547.1.51346 WP_000044547.1.51376 WP_000044547.1.51454 WP_000044547.1.51492 WP_000044547.1.51527 WP_000044547.1.51559 WP_000044547.1.51575 WP_000044547.1.51590 WP_000044547.1.51665 WP_000044547.1.51716 WP_000044547.1.51748 WP_000044547.1.51797 WP_000044547.1.51842 WP_000044547.1.51844 WP_000044547.1.51871 WP_000044547.1.51883 WP_000044547.1.51924 WP_000044547.1.51936 WP_000044547.1.51952 WP_000044547.1.51971 WP_000044547.1.51995 WP_000044547.1.52078 WP_000044547.1.521 WP_000044547.1.5213 WP_000044547.1.52182 WP_000044547.1.52193 WP_000044547.1.52251 WP_000044547.1.52296 WP_000044547.1.52327 WP_000044547.1.52442 WP_000044547.1.52518 WP_000044547.1.52548 WP_000044547.1.52595 WP_000044547.1.52624 WP_000044547.1.52645 WP_000044547.1.52848 WP_000044547.1.52877 WP_000044547.1.52878 WP_000044547.1.52941 WP_000044547.1.52947 WP_000044547.1.52984 WP_000044547.1.53002 WP_000044547.1.53071 WP_000044547.1.53140 WP_000044547.1.53153 WP_000044547.1.53178 WP_000044547.1.53209 WP_000044547.1.53260 WP_000044547.1.53317 WP_000044547.1.53319 WP_000044547.1.53394 WP_000044547.1.53403 WP_000044547.1.53432 WP_000044547.1.53462 WP_000044547.1.53521 WP_000044547.1.53577 WP_000044547.1.53641 WP_000044547.1.53648 WP_000044547.1.53671 WP_000044547.1.53766 WP_000044547.1.53827 WP_000044547.1.53915 WP_000044547.1.53934 WP_000044547.1.53969 WP_000044547.1.53999 WP_000044547.1.54022 WP_000044547.1.54109 WP_000044547.1.54147 WP_000044547.1.54229 WP_000044547.1.54253 WP_000044547.1.54297 WP_000044547.1.54395 WP_000044547.1.544 WP_000044547.1.54413 WP_000044547.1.54503 WP_000044547.1.54551 WP_000044547.1.54637 WP_000044547.1.54675 WP_000044547.1.5469 WP_000044547.1.54878 WP_000044547.1.54955 WP_000044547.1.55014 WP_000044547.1.5519 WP_000044547.1.55274 WP_000044547.1.55369 WP_000044547.1.55403 WP_000044547.1.55405 WP_000044547.1.55421 WP_000044547.1.55508 WP_000044547.1.5554 WP_000044547.1.55544 WP_000044547.1.5556 WP_000044547.1.5559 WP_000044547.1.55628 WP_000044547.1.55637 WP_000044547.1.55653 WP_000044547.1.55786 WP_000044547.1.5580 WP_000044547.1.55818 WP_000044547.1.55835 WP_000044547.1.55867 WP_000044547.1.55886 WP_000044547.1.55904 WP_000044547.1.55916 WP_000044547.1.55933 WP_000044547.1.56000 WP_000044547.1.56025 WP_000044547.1.56048 WP_000044547.1.56098 WP_000044547.1.5623 WP_000044547.1.56281 WP_000044547.1.56333 WP_000044547.1.5644 WP_000044547.1.5658 WP_000044547.1.566 WP_000044547.1.56628 WP_000044547.1.56641 WP_000044547.1.5677 WP_000044547.1.56794 WP_000044547.1.56856 WP_000044547.1.5686 WP_000044547.1.56878 WP_000044547.1.56986 WP_000044547.1.57047 WP_000044547.1.57075 WP_000044547.1.57097 WP_000044547.1.57109 WP_000044547.1.57170 WP_000044547.1.5718 WP_000044547.1.57214 WP_000044547.1.57265 WP_000044547.1.57309 WP_000044547.1.57445 WP_000044547.1.57481 WP_000044547.1.57594 WP_000044547.1.57650 WP_000044547.1.57665 WP_000044547.1.57682 WP_000044547.1.57692 WP_000044547.1.57730 WP_000044547.1.57734 WP_000044547.1.57808 WP_000044547.1.57819 WP_000044547.1.57837 WP_000044547.1.57861 WP_000044547.1.57974 WP_000044547.1.58016 WP_000044547.1.58049 WP_000044547.1.58074 WP_000044547.1.58158 WP_000044547.1.5816 WP_000044547.1.58317 WP_000044547.1.58352 WP_000044547.1.58395 WP_000044547.1.58430 WP_000044547.1.58512 WP_000044547.1.58530 WP_000044547.1.5857 WP_000044547.1.58571 WP_000044547.1.58592 WP_000044547.1.58598 WP_000044547.1.58704 WP_000044547.1.58735 WP_000044547.1.58760 WP_000044547.1.58763 WP_000044547.1.5880 WP_000044547.1.58934 WP_000044547.1.58981 WP_000044547.1.59014 WP_000044547.1.59077 WP_000044547.1.59124 WP_000044547.1.59146 WP_000044547.1.5920 WP_000044547.1.59311 WP_000044547.1.59462 WP_000044547.1.59464 WP_000044547.1.59598 WP_000044547.1.59668 WP_000044547.1.59669 WP_000044547.1.59671 WP_000044547.1.5972 WP_000044547.1.5982 WP_000044547.1.59822 WP_000044547.1.59874 WP_000044547.1.59907 WP_000044547.1.59915 WP_000044547.1.60006 WP_000044547.1.60123 WP_000044547.1.60149 WP_000044547.1.60157 WP_000044547.1.6017 WP_000044547.1.60227 WP_000044547.1.60302 WP_000044547.1.60353 WP_000044547.1.60360 WP_000044547.1.60434 WP_000044547.1.60585 WP_000044547.1.60595 WP_000044547.1.60636 WP_000044547.1.60641 WP_000044547.1.60751 WP_000044547.1.60759 WP_000044547.1.60765 WP_000044547.1.60778 WP_000044547.1.60820 WP_000044547.1.60845 WP_000044547.1.60869 WP_000044547.1.60888 WP_000044547.1.60923 WP_000044547.1.60948 WP_000044547.1.60965 WP_000044547.1.60991 WP_000044547.1.61026 WP_000044547.1.61029 WP_000044547.1.61031 WP_000044547.1.61115 WP_000044547.1.61139 WP_000044547.1.61189 WP_000044547.1.6119 WP_000044547.1.6123 WP_000044547.1.61263 WP_000044547.1.61316 WP_000044547.1.6136 WP_000044547.1.61375 WP_000044547.1.61439 WP_000044547.1.61440 WP_000044547.1.61555 WP_000044547.1.61585 WP_000044547.1.61597 WP_000044547.1.61639 WP_000044547.1.6166 WP_000044547.1.61705 WP_000044547.1.61749 WP_000044547.1.61802 WP_000044547.1.61936 WP_000044547.1.61978 WP_000044547.1.62002 WP_000044547.1.6201 WP_000044547.1.62028 WP_000044547.1.62069 WP_000044547.1.62071 WP_000044547.1.62096 WP_000044547.1.62247 WP_000044547.1.62346 WP_000044547.1.62352 WP_000044547.1.62382 WP_000044547.1.62398 WP_000044547.1.62453 WP_000044547.1.62474 WP_000044547.1.6250 WP_000044547.1.62553 WP_000044547.1.62602 WP_000044547.1.62653 WP_000044547.1.62671 WP_000044547.1.62674 WP_000044547.1.62684 WP_000044547.1.62723 WP_000044547.1.62764 WP_000044547.1.62771 WP_000044547.1.62824 WP_000044547.1.62831 WP_000044547.1.62863 WP_000044547.1.62880 WP_000044547.1.62970 WP_000044547.1.63003 WP_000044547.1.63027 WP_000044547.1.63070 WP_000044547.1.63083 WP_000044547.1.63139 WP_000044547.1.63140 WP_000044547.1.63220 WP_000044547.1.63266 WP_000044547.1.63289 WP_000044547.1.63304 WP_000044547.1.63313 WP_000044547.1.63333 WP_000044547.1.63341 WP_000044547.1.63469 WP_000044547.1.63678 WP_000044547.1.63726 WP_000044547.1.63729 WP_000044547.1.63751 WP_000044547.1.63759 WP_000044547.1.63774 WP_000044547.1.63907 WP_000044547.1.6403 WP_000044547.1.6408 WP_000044547.1.64192 WP_000044547.1.64250 WP_000044547.1.64367 WP_000044547.1.6438 WP_000044547.1.64456 WP_000044547.1.64457 WP_000044547.1.64565 WP_000044547.1.64583 WP_000044547.1.6459 WP_000044547.1.6462 WP_000044547.1.64677 WP_000044547.1.64686 WP_000044547.1.64720 WP_000044547.1.6479 WP_000044547.1.64858 WP_000044547.1.64879 WP_000044547.1.6488 WP_000044547.1.64893 WP_000044547.1.64897 WP_000044547.1.64935 WP_000044547.1.64961 WP_000044547.1.65044 WP_000044547.1.65158 WP_000044547.1.65217 WP_000044547.1.65419 WP_000044547.1.65423 WP_000044547.1.65432 WP_000044547.1.65451 WP_000044547.1.6547 WP_000044547.1.6551 WP_000044547.1.65520 WP_000044547.1.65562 WP_000044547.1.65675 WP_000044547.1.65689 WP_000044547.1.65693 WP_000044547.1.65700 WP_000044547.1.65703 WP_000044547.1.65705 WP_000044547.1.65856 WP_000044547.1.65922 WP_000044547.1.66175 WP_000044547.1.66262 WP_000044547.1.66302 WP_000044547.1.66505 WP_000044547.1.66519 WP_000044547.1.66542 WP_000044547.1.66564 WP_000044547.1.66588 WP_000044547.1.66601 WP_000044547.1.66664 WP_000044547.1.66677 WP_000044547.1.66711 WP_000044547.1.66786 WP_000044547.1.66818 WP_000044547.1.6684 WP_000044547.1.67112 WP_000044547.1.67135 WP_000044547.1.67191 WP_000044547.1.6722 WP_000044547.1.67266 WP_000044547.1.67329 WP_000044547.1.67333 WP_000044547.1.67379 WP_000044547.1.6740 WP_000044547.1.67414 WP_000044547.1.67463 WP_000044547.1.67507 WP_000044547.1.67521 WP_000044547.1.67554 WP_000044547.1.67632 WP_000044547.1.67651 WP_000044547.1.67652 WP_000044547.1.67722 WP_000044547.1.67754 WP_000044547.1.67815 WP_000044547.1.6786 WP_000044547.1.67865 WP_000044547.1.67925 WP_000044547.1.67986 WP_000044547.1.68054 WP_000044547.1.68066 WP_000044547.1.6811 WP_000044547.1.68111 WP_000044547.1.68160 WP_000044547.1.68161 WP_000044547.1.68261 WP_000044547.1.68295 WP_000044547.1.6830 WP_000044547.1.6834 WP_000044547.1.68343 WP_000044547.1.68351 WP_000044547.1.68367 WP_000044547.1.68404 WP_000044547.1.68425 WP_000044547.1.68483 WP_000044547.1.68489 WP_000044547.1.68565 WP_000044547.1.68650 WP_000044547.1.68699 WP_000044547.1.68703 WP_000044547.1.68728 WP_000044547.1.68775 WP_000044547.1.68813 WP_000044547.1.68854 WP_000044547.1.68875 WP_000044547.1.68943 WP_000044547.1.68944 WP_000044547.1.69045 WP_000044547.1.69087 WP_000044547.1.69089 WP_000044547.1.6917 WP_000044547.1.69191 WP_000044547.1.69237 WP_000044547.1.69366 WP_000044547.1.69395 WP_000044547.1.69476 WP_000044547.1.695 WP_000044547.1.69563 WP_000044547.1.69679 WP_000044547.1.69987 WP_000044547.1.70024 WP_000044547.1.70048 WP_000044547.1.70105 WP_000044547.1.7012 WP_000044547.1.70133 WP_000044547.1.7024 WP_000044547.1.70253 WP_000044547.1.70273 WP_000044547.1.7034 WP_000044547.1.70344 WP_000044547.1.70349 WP_000044547.1.7043 WP_000044547.1.70459 WP_000044547.1.7053 WP_000044547.1.70546 WP_000044547.1.7061 WP_000044547.1.70635 WP_000044547.1.70641 WP_000044547.1.7073 WP_000044547.1.70818 WP_000044547.1.70924 WP_000044547.1.70930 WP_000044547.1.70943 WP_000044547.1.71059 WP_000044547.1.71073 WP_000044547.1.7109 WP_000044547.1.71130 WP_000044547.1.71196 WP_000044547.1.7120 WP_000044547.1.71257 WP_000044547.1.71295 WP_000044547.1.71298 WP_000044547.1.71359 WP_000044547.1.71463 WP_000044547.1.71519 WP_000044547.1.71543 WP_000044547.1.71596 WP_000044547.1.71602 WP_000044547.1.7161 WP_000044547.1.71662 WP_000044547.1.71735 WP_000044547.1.7179 WP_000044547.1.71925 WP_000044547.1.71989 WP_000044547.1.72026 WP_000044547.1.72031 WP_000044547.1.72169 WP_000044547.1.72205 WP_000044547.1.72271 WP_000044547.1.72330 WP_000044547.1.72347 WP_000044547.1.72366 WP_000044547.1.72424 WP_000044547.1.72547 WP_000044547.1.72654 WP_000044547.1.72787 WP_000044547.1.72832 WP_000044547.1.72835 WP_000044547.1.72903 WP_000044547.1.72904 WP_000044547.1.72935 WP_000044547.1.72945 WP_000044547.1.73017 WP_000044547.1.73022 WP_000044547.1.73037 WP_000044547.1.73122 WP_000044547.1.73132 WP_000044547.1.73265 WP_000044547.1.73286 WP_000044547.1.73501 WP_000044547.1.73591 WP_000044547.1.73639 WP_000044547.1.73735 WP_000044547.1.73759 WP_000044547.1.73786 WP_000044547.1.7380 WP_000044547.1.73834 WP_000044547.1.73858 WP_000044547.1.73910 WP_000044547.1.73920 WP_000044547.1.73969 WP_000044547.1.73976 WP_000044547.1.73983 WP_000044547.1.74006 WP_000044547.1.74081 WP_000044547.1.74157 WP_000044547.1.74161 WP_000044547.1.74173 WP_000044547.1.74216 WP_000044547.1.74234 WP_000044547.1.74237 WP_000044547.1.7434 WP_000044547.1.74353 WP_000044547.1.74356 WP_000044547.1.74380 WP_000044547.1.74429 WP_000044547.1.74457 WP_000044547.1.7457 WP_000044547.1.74638 WP_000044547.1.74696 WP_000044547.1.74704 WP_000044547.1.74747 WP_000044547.1.74802 WP_000044547.1.74866 WP_000044547.1.74890 WP_000044547.1.74911 WP_000044547.1.74922 WP_000044547.1.74961 WP_000044547.1.74999 WP_000044547.1.75044 WP_000044547.1.75052 WP_000044547.1.75252 WP_000044547.1.75294 WP_000044547.1.75298 WP_000044547.1.75320 WP_000044547.1.75327 WP_000044547.1.75349 WP_000044547.1.75365 WP_000044547.1.75399 WP_000044547.1.7542 WP_000044547.1.75440 WP_000044547.1.75527 WP_000044547.1.75551 WP_000044547.1.7561 WP_000044547.1.75649 WP_000044547.1.75652 WP_000044547.1.75685 WP_000044547.1.75775 WP_000044547.1.75830 WP_000044547.1.75881 WP_000044547.1.75885 WP_000044547.1.75929 WP_000044547.1.75952 WP_000044547.1.7596 WP_000044547.1.75969 WP_000044547.1.76015 WP_000044547.1.76095 WP_000044547.1.76230 WP_000044547.1.76234 WP_000044547.1.7624 WP_000044547.1.7625 WP_000044547.1.76258 WP_000044547.1.76332 WP_000044547.1.76351 WP_000044547.1.76419 WP_000044547.1.76606 WP_000044547.1.76624 WP_000044547.1.76693 WP_000044547.1.7675 WP_000044547.1.76790 WP_000044547.1.768 WP_000044547.1.76816 WP_000044547.1.76839 WP_000044547.1.76921 WP_000044547.1.76944 WP_000044547.1.76952 WP_000044547.1.77041 WP_000044547.1.77060 WP_000044547.1.77062 WP_000044547.1.77112 WP_000044547.1.77145 WP_000044547.1.77305 WP_000044547.1.77489 WP_000044547.1.77497 WP_000044547.1.77520 WP_000044547.1.77527 WP_000044547.1.77533 WP_000044547.1.77572 WP_000044547.1.77606 WP_000044547.1.77738 WP_000044547.1.7774 WP_000044547.1.77743 WP_000044547.1.77818 WP_000044547.1.77848 WP_000044547.1.77858 WP_000044547.1.7787 WP_000044547.1.77957 WP_000044547.1.78091 WP_000044547.1.78173 WP_000044547.1.78189 WP_000044547.1.78207 WP_000044547.1.78252 WP_000044547.1.78254 WP_000044547.1.78332 WP_000044547.1.78404 WP_000044547.1.7850 WP_000044547.1.78558 WP_000044547.1.7857 WP_000044547.1.78604 WP_000044547.1.78667 WP_000044547.1.78728 WP_000044547.1.78841 WP_000044547.1.78897 WP_000044547.1.78983 WP_000044547.1.7900 WP_000044547.1.79006 WP_000044547.1.79038 WP_000044547.1.79051 WP_000044547.1.79085 WP_000044547.1.79131 WP_000044547.1.79170 WP_000044547.1.79197 WP_000044547.1.79208 WP_000044547.1.79223 WP_000044547.1.79310 WP_000044547.1.79314 WP_000044547.1.79322 WP_000044547.1.79367 WP_000044547.1.79374 WP_000044547.1.79436 WP_000044547.1.79461 WP_000044547.1.79476 WP_000044547.1.79487 WP_000044547.1.79539 WP_000044547.1.79626 WP_000044547.1.79662 WP_000044547.1.79706 WP_000044547.1.79822 WP_000044547.1.79831 WP_000044547.1.79837 WP_000044547.1.79896 WP_000044547.1.79911 WP_000044547.1.79941 WP_000044547.1.79961 WP_000044547.1.79971 WP_000044547.1.79991 WP_000044547.1.80032 WP_000044547.1.80042 WP_000044547.1.80079 WP_000044547.1.80109 WP_000044547.1.80127 WP_000044547.1.80203 WP_000044547.1.80287 WP_000044547.1.80290 WP_000044547.1.8031 WP_000044547.1.80358 WP_000044547.1.80378 WP_000044547.1.80472 WP_000044547.1.80530 WP_000044547.1.80687 WP_000044547.1.80761 WP_000044547.1.80763 WP_000044547.1.80781 WP_000044547.1.80786 WP_000044547.1.80833 WP_000044547.1.8084 WP_000044547.1.80962 WP_000044547.1.81085 WP_000044547.1.81114 WP_000044547.1.81171 WP_000044547.1.81252 WP_000044547.1.8135 WP_000044547.1.81385 WP_000044547.1.81389 WP_000044547.1.8142 WP_000044547.1.8144 WP_000044547.1.81464 WP_000044547.1.81467 WP_000044547.1.81740 WP_000044547.1.81758 WP_000044547.1.81810 WP_000044547.1.81812 WP_000044547.1.81831 WP_000044547.1.81861 WP_000044547.1.81870 WP_000044547.1.81897 WP_000044547.1.81903 WP_000044547.1.81905 WP_000044547.1.81919 WP_000044547.1.81944 WP_000044547.1.81955 WP_000044547.1.81999 WP_000044547.1.82009 WP_000044547.1.82121 WP_000044547.1.82219 WP_000044547.1.82247 WP_000044547.1.82259 WP_000044547.1.82340 WP_000044547.1.82354 WP_000044547.1.82358 WP_000044547.1.82368 WP_000044547.1.82447 WP_000044547.1.8246 WP_000044547.1.82467 WP_000044547.1.82548 WP_000044547.1.82612 WP_000044547.1.82724 WP_000044547.1.82796 WP_000044547.1.8280 WP_000044547.1.82862 WP_000044547.1.8289 WP_000044547.1.82976 WP_000044547.1.83152 WP_000044547.1.83153 WP_000044547.1.83193 WP_000044547.1.83234 WP_000044547.1.83316 WP_000044547.1.83352 WP_000044547.1.83372 WP_000044547.1.83418 WP_000044547.1.83517 WP_000044547.1.83646 WP_000044547.1.83653 WP_000044547.1.83676 WP_000044547.1.83769 WP_000044547.1.83825 WP_000044547.1.8383 WP_000044547.1.83864 WP_000044547.1.83865 WP_000044547.1.83881 WP_000044547.1.83912 WP_000044547.1.83919 WP_000044547.1.83955 WP_000044547.1.83984 WP_000044547.1.84049 WP_000044547.1.84144 WP_000044547.1.84163 WP_000044547.1.84442 WP_000044547.1.84445 WP_000044547.1.84451 WP_000044547.1.84563 WP_000044547.1.84625 WP_000044547.1.84638 WP_000044547.1.84682 WP_000044547.1.84752 WP_000044547.1.84761 WP_000044547.1.84815 WP_000044547.1.84889 WP_000044547.1.84903 WP_000044547.1.84907 WP_000044547.1.84922 WP_000044547.1.8493 WP_000044547.1.85022 WP_000044547.1.85056 WP_000044547.1.85081 WP_000044547.1.85135 WP_000044547.1.85144 WP_000044547.1.85151 WP_000044547.1.85213 WP_000044547.1.85226 WP_000044547.1.85235 WP_000044547.1.85238 WP_000044547.1.85351 WP_000044547.1.85383 WP_000044547.1.85395 WP_000044547.1.85445 WP_000044547.1.85462 WP_000044547.1.85471 WP_000044547.1.85474 WP_000044547.1.85492 WP_000044547.1.85515 WP_000044547.1.85547 WP_000044547.1.85586 WP_000044547.1.85649 WP_000044547.1.85795 WP_000044547.1.85816 WP_000044547.1.85927 WP_000044547.1.85950 WP_000044547.1.85993 WP_000044547.1.86018 WP_000044547.1.86072 WP_000044547.1.86123 WP_000044547.1.86144 WP_000044547.1.86154 WP_000044547.1.86158 WP_000044547.1.86188 WP_000044547.1.86207 WP_000044547.1.8627 WP_000044547.1.86270 WP_000044547.1.86344 WP_000044547.1.86367 WP_000044547.1.86378 WP_000044547.1.8643 WP_000044547.1.86439 WP_000044547.1.86482 WP_000044547.1.86523 WP_000044547.1.86542 WP_000044547.1.86628 WP_000044547.1.86706 WP_000044547.1.86792 WP_000044547.1.86838 WP_000044547.1.86911 WP_000044547.1.86961 WP_000044547.1.86977 WP_000044547.1.87042 WP_000044547.1.87057 WP_000044547.1.87072 WP_000044547.1.87090 WP_000044547.1.87119 WP_000044547.1.87122 WP_000044547.1.87175 WP_000044547.1.87194 WP_000044547.1.8720 WP_000044547.1.87260 WP_000044547.1.87261 WP_000044547.1.87285 WP_000044547.1.8731 WP_000044547.1.87396 WP_000044547.1.87457 WP_000044547.1.87461 WP_000044547.1.875 WP_000044547.1.87508 WP_000044547.1.87515 WP_000044547.1.8753 WP_000044547.1.87543 WP_000044547.1.87710 WP_000044547.1.87718 WP_000044547.1.87748 WP_000044547.1.87764 WP_000044547.1.87808 WP_000044547.1.87828 WP_000044547.1.87912 WP_000044547.1.87963 WP_000044547.1.87972 WP_000044547.1.87995 WP_000044547.1.88013 WP_000044547.1.88032 WP_000044547.1.88061 WP_000044547.1.88114 WP_000044547.1.88150 WP_000044547.1.88270 WP_000044547.1.88319 WP_000044547.1.88351 WP_000044547.1.88371 WP_000044547.1.88480 WP_000044547.1.88498 WP_000044547.1.88518 WP_000044547.1.88558 WP_000044547.1.8857 WP_000044547.1.88580 WP_000044547.1.88599 WP_000044547.1.88623 WP_000044547.1.88636 WP_000044547.1.88739 WP_000044547.1.88856 WP_000044547.1.88859 WP_000044547.1.8888 WP_000044547.1.88922 WP_000044547.1.88934 WP_000044547.1.8900 WP_000044547.1.89086 WP_000044547.1.8913 WP_000044547.1.89133 WP_000044547.1.89194 WP_000044547.1.89195 WP_000044547.1.89204 WP_000044547.1.8924 WP_000044547.1.89258 WP_000044547.1.89284 WP_000044547.1.89537 WP_000044547.1.89545 WP_000044547.1.89559 WP_000044547.1.89655 WP_000044547.1.89672 WP_000044547.1.89678 WP_000044547.1.89726 WP_000044547.1.89754 WP_000044547.1.89883 WP_000044547.1.89960 WP_000044547.1.90018 WP_000044547.1.90038 WP_000044547.1.90046 WP_000044547.1.90055 WP_000044547.1.90131 WP_000044547.1.90148 WP_000044547.1.90161 WP_000044547.1.90215 WP_000044547.1.9022 WP_000044547.1.90243 WP_000044547.1.90253 WP_000044547.1.9030 WP_000044547.1.90331 WP_000044547.1.90473 WP_000044547.1.90544 WP_000044547.1.90554 WP_000044547.1.90647 WP_000044547.1.90660 WP_000044547.1.90683 WP_000044547.1.90726 WP_000044547.1.90738 WP_000044547.1.90745 WP_000044547.1.90801 WP_000044547.1.90804 WP_000044547.1.90861 WP_000044547.1.90896 WP_000044547.1.90903 WP_000044547.1.9100 WP_000044547.1.91011 WP_000044547.1.91126 WP_000044547.1.9114 WP_000044547.1.91158 WP_000044547.1.91177 WP_000044547.1.912 WP_000044547.1.91233 WP_000044547.1.91246 WP_000044547.1.91258 WP_000044547.1.91346 WP_000044547.1.91357 WP_000044547.1.91364 WP_000044547.1.91382 WP_000044547.1.9140 WP_000044547.1.91420 WP_000044547.1.91427 WP_000044547.1.91487 WP_000044547.1.91500 WP_000044547.1.91559 WP_000044547.1.91581 WP_000044547.1.91587 WP_000044547.1.91639 WP_000044547.1.91771 WP_000044547.1.91791 WP_000044547.1.91816 WP_000044547.1.91829 WP_000044547.1.91895 WP_000044547.1.91950 WP_000044547.1.92133 WP_000044547.1.92140 WP_000044547.1.92164 WP_000044547.1.92169 WP_000044547.1.92185 WP_000044547.1.92196 WP_000044547.1.9234 WP_000044547.1.9239 WP_000044547.1.92436 WP_000044547.1.92497 WP_000044547.1.92500 WP_000044547.1.92534 WP_000044547.1.92607 WP_000044547.1.92691 WP_000044547.1.92723 WP_000044547.1.92735 WP_000044547.1.92741 WP_000044547.1.92773 WP_000044547.1.92789 WP_000044547.1.92805 WP_000044547.1.9293 WP_000044547.1.93163 WP_000044547.1.93191 WP_000044547.1.93224 WP_000044547.1.93300 WP_000044547.1.93416 WP_000044547.1.93438 WP_000044547.1.93444 WP_000044547.1.93514 WP_000044547.1.9352 WP_000044547.1.9354 WP_000044547.1.9358 WP_000044547.1.93590 WP_000044547.1.93678 WP_000044547.1.93710 WP_000044547.1.93722 WP_000044547.1.93738 WP_000044547.1.93769 WP_000044547.1.93787 WP_000044547.1.9387 WP_000044547.1.93882 WP_000044547.1.93891 WP_000044547.1.93981 WP_000044547.1.94074 WP_000044547.1.94082 WP_000044547.1.94087 WP_000044547.1.94096 WP_000044547.1.94119 WP_000044547.1.94165 WP_000044547.1.94172 WP_000044547.1.94293 WP_000044547.1.94294 WP_000044547.1.94335 WP_000044547.1.94340 WP_000044547.1.9437 WP_000044547.1.94375 WP_000044547.1.94389 WP_000044547.1.94414 WP_000044547.1.94530 WP_000044547.1.94550 WP_000044547.1.94688 WP_000044547.1.94733 WP_000044547.1.94741 WP_000044547.1.94797 WP_000044547.1.94844 WP_000044547.1.94845 WP_000044547.1.9485 WP_000044547.1.94866 WP_000044547.1.9497 WP_000044547.1.94980 WP_000044547.1.94999 WP_000044547.1.95038 WP_000044547.1.95077 WP_000044547.1.9510 WP_000044547.1.95120 WP_000044547.1.95342 WP_000044547.1.95372 WP_000044547.1.9538 WP_000044547.1.95581 WP_000044547.1.95603 WP_000044547.1.95639 WP_000044547.1.95681 WP_000044547.1.95714 WP_000044547.1.95737 WP_000044547.1.95806 WP_000044547.1.95877 WP_000044547.1.95885 WP_000044547.1.95914 WP_000044547.1.95918 WP_000044547.1.95986 WP_000044547.1.95997 WP_000044547.1.96030 WP_000044547.1.96057 WP_000044547.1.96067 WP_000044547.1.96075 WP_000044547.1.96148 WP_000044547.1.96255 WP_000044547.1.96283 WP_000044547.1.96297 WP_000044547.1.96312 WP_000044547.1.96314 WP_000044547.1.96322 WP_000044547.1.96334 WP_000044547.1.96362 WP_000044547.1.96472 WP_000044547.1.9650 WP_000044547.1.96535 WP_000044547.1.96538 WP_000044547.1.96554 WP_000044547.1.96603 WP_000044547.1.96678 WP_000044547.1.96705 WP_000044547.1.9675 WP_000044547.1.96780 WP_000044547.1.96855 WP_000044547.1.96859 WP_000044547.1.96922 WP_000044547.1.96969 WP_000044547.1.96985 WP_000044547.1.97014 WP_000044547.1.97034 WP_000044547.1.97141 WP_000044547.1.97161 WP_000044547.1.97164 WP_000044547.1.97205 WP_000044547.1.97228 WP_000044547.1.97230 WP_000044547.1.97241 WP_000044547.1.97367 WP_000044547.1.97427 WP_000044547.1.97450 WP_000044547.1.97456 WP_000044547.1.97494 WP_000044547.1.97530 WP_000044547.1.97531 WP_000044547.1.97585 WP_000044547.1.97687 WP_000044547.1.97696 WP_000044547.1.97699 WP_000044547.1.97744 WP_000044547.1.97746 WP_000044547.1.97762 WP_000044547.1.9788 WP_000044547.1.97935 WP_000044547.1.97955 WP_000044547.1.97974 WP_000044547.1.98054 WP_000044547.1.98058 WP_000044547.1.98073 WP_000044547.1.98161 WP_000044547.1.98174 WP_000044547.1.98195 WP_000044547.1.98233 WP_000044547.1.98248 WP_000044547.1.98249 WP_000044547.1.98328 WP_000044547.1.98352 WP_000044547.1.98366 WP_000044547.1.98387 WP_000044547.1.98409 WP_000044547.1.98425 WP_000044547.1.98585 WP_000044547.1.98609 WP_000044547.1.98659 WP_000044547.1.98667 WP_000044547.1.9872 WP_000044547.1.98723 WP_000044547.1.98730 WP_000044547.1.98734 WP_000044547.1.98741 WP_000044547.1.98750 WP_000044547.1.98786 WP_000044547.1.98821 WP_000044547.1.98880 WP_000044547.1.98883 WP_000044547.1.98978 WP_000044547.1.98985 WP_000044547.1.99136 WP_000044547.1.99308 WP_000044547.1.99414 WP_000044547.1.99418 WP_000044547.1.9965 WP_000044547.1.99830 WP_000044547.1.99859 WP_000044547.1.99884 WP_000044547.1.99954 WP_000044547.1.99955 WP_000044547.1.99984 WP_000044547.1.99999 gi|156980969|ref|YP_001443228.1| gi|387151778|ref|YP_005743342.1| gi|470196164|ref|YP_007582516.1| gi|470200098|ref|YP_007586498.1| gi|470194198|ref|YP_007580551.1| gi|470192233|ref|YP_007578543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]