SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 159087.Daro_0888 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  159087.Daro_0888
Domain Number 1 Region: 286-412,449-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.35e-20
Family Legume lectins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 159087.Daro_0888
Sequence length 1191
Comment (Dechloromonas aromatica RCB)
Sequence
MAIRIRSELLATLFSLSCLFSGDVLAARTVTSATVDGGSVTTVAPGASITAVVNASTSGS
DNNWQCTTWAIAASSPGTPTAVNHSNHNSSGSYSETFAMTAPSVAGTYNVYFVAYNNDAC
TTGASSYTLASAVIVDARPNVLSISRSSSNPAAPNSSVTWQVVFDRSVTGVDSGDFSLLQ
GSGATGASITAVSGSGTTWTVTANTGTGTSGTLQLNLVDNDTIVSSADGTKLGGTGAGNG
NFSGEAYTIISSSCVPPANTPSGLVLTCQCDSFGRSTLNPSPMFTTSNWVVSTSDTTGVV
PYLNTSTGFLRLTEKTGNNAKAATAPGFFPAAGNYISVEFKHYAYNGSGADGIAVTLSDY
TVPAVPGAFGGSLGYAQKTAGGTVPGFAGGWIGIAVDEYGNYSNPTEGRVGGVGFIADAV
AVRGSGSGTSGYPYLGGSGSTLSPGVDNAASTTPAYGHYYQVIVDARNAASGKTLVAVNR
DTTGTRASYASVVPSFDAFAAATLAGYTQAAVPANWQLSFTGSTGGSTNIHELGEVRICA
QNYVPPDGGTAGGFSAIDDAYSSTIQNFLTGHIYTKLVGTAFKLKVAALSNSQILTTYAA
SGTKNVAIKLVDNSDGACGADANRATACATSACNGKTAVTGGSQTLAYTSTDKGIKTTAD
FTINTAYANLVAVMSEGAVTACSVDTFAVRPTRFSSVTSSATNATLTGAPKFKAGTDSFT
LTATANAAGYSGTPKISSSGMSATAAGWTVGSLSPIIFPNATPGASTSVATGSFTYSEVG
NFRFLGFDPATDTTSVRGVYDDDWVAVDSAATKNDCVAGSYSNAKDASGKYGCLFGLLDS
GTSAPNSVLFGRFIPDRIAYLGGGVTSFCSSGTKPFTYMGQPQMGIAYRLQAVNGAGVVT
KNYSQALGYPVVNPSLVAEDQDTANQGCDLASRIGGLAAAQWSSGLYVINDANADNAPDT
SAVSFSRPASPVALSLATCAANRASAGGPFWLLDIGVALNDTTDGVAIDGMDMNSATTGI
CSVAACSARKIGTTGVVDGRLWLNNAYGSEMLPLSVPVLAQYWSSAGWRTNSYDSCTALT
QPTRQDTGNAGLVFYAPPDTARNGLAPGEAVAQMNGSTAASVAMVNGDGKLVLRGLASSS
IGPGVGNFGYVDVIGSKLTPSASWLPATGNARACFGSCGPRSPVIYFRERY
Download sequence
Identical sequences Q47HN7
159087.Daro_0888 gi|71906527|ref|YP_284114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]