SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 159087.Daro_2448 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  159087.Daro_2448
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.33e-52
Family Ribonuclease PH domain 1-like 0.00001
Further Details:      
 
Domain Number 2 Region: 293-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-47
Family Ribonuclease PH domain 1-like 0.0000187
Further Details:      
 
Domain Number 3 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.52e-30
Family Ribonuclease PH domain 2-like 0.00084
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.17e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 556-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.17e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 6 Region: 621-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.03e-20
Family Cold shock DNA-binding domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 159087.Daro_2448
Sequence length 715
Comment (Dechloromonas aromatica RCB)
Sequence
MFNVVKKTFAYGDHQVTIETGEVARQAGGAVLVSMEETVVLVTVVAAKNAKPGQDFFPLT
VDYQEKTYAAGRIPGGFFKREGRPSEKETLTCRLIDRPIRPLFPDGFYNEVQVIATVMSL
NPEIDSDIPALIGASAALAISGVPFNGPIGAARVGYIDGQYVLCPTLSQLKGSQLDLVVA
GTEAAVLMVESEADQLSEEVMLGAVVFGHTEMQKAINAINELVEEAGKPEWEWEAAPKDE
ALVASLSALVSAKLEEAYNITVKQTRSQAVKAIRAEAVAALCTGAEGAPDENTVGNLFHE
IEASIVRGRILSGAPRIDGRDTRTVRPITMRSGVLPRTHGSALFTRGETQALAVATLGTN
RDEQIIDALAGEYRDRFMLHYNMPPYATGECGRVGTPKRREIGHGRLAKRALLAVLPKPE
DFSYSMRLVSEITESNGSSSMASVCGGCLALLDAGVPLKAHVAGIAMGLIKDGNRFAVLT
DILGDEDHLGDMDFKVAGSTTGITALQMDIKIQGITKEIMQVALAQAKEARIHILNLMQE
SAAGPREEMSAYAPRLYTFKINPEKIRDVIGKGGAVIRALTEETGTTIDIQDDGTITIAA
TSGEAAAAARSRIDAITAEVEIGKIYEGTVLKILDFGAIVSVLPGKDGLLHISQIAQERV
NKVEDYVKEGQIVRVKVLETDDRGRVKLSMKAAAADEGTVAQPVAAPEAAVQQQQ
Download sequence
Identical sequences Q47D98
159087.Daro_2448 gi|71908066|ref|YP_285653.1| WP_011288182.1.67134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]