SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 159087.Daro_3484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  159087.Daro_3484
Domain Number 1 Region: 8-127
Classification Level Classification E-value
Superfamily ApaG-like 1.11e-49
Family ApaG-like 0.00000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 159087.Daro_3484
Sequence length 127
Comment (Dechloromonas aromatica RCB)
Sequence
MSDTNKYRIEVQPMPQFIPEQSDPENDRYIFAYTITIKNIGEVPAQLVSRHWIITDGNNE
VQEVRGLGVVGKQPLLQPGESFQYTSGSSLTTAIGTMKGTYQMVAEDGTHFEAEIPEFVL
ASPRALH
Download sequence
Identical sequences Q47AB8
WP_011289209.1.67134 gi|71909096|ref|YP_286683.1| 2005283598 159087.Daro_3484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]