SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160488.PP_1995 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_1995
Domain Number 1 Region: 6-204
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.08e-63
Family Tryptophan biosynthesis enzymes 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_1995
Sequence length 206
Comment (Pseudomonas putida KT2440)
Sequence
MSNVRSKICGITRIEDALAAAEAGADAIGFVFYAKSPRAVDVRQARAIIAELPPFVTTVG
LFVNASRCELNEILEVVPLDLLQFHGDETPQDCEGYHRPWIKALRVRPGDDLEAACRLYA
GARGILLDTYVPGVPGGTGEAFDWSLVPARLGKPIILAGGLSADNVGQAIAQVKPYAVDV
SGGVEQAKGIKDAAKIEAFMRAVKQA
Download sequence
Identical sequences A0A0A7Q3V7 A0A179SD97 Q88LE0
160488.PP_1995 gi|26988720|ref|NP_744145.1| NP_744145.1.35174 WP_010953008.1.28295 WP_010953008.1.3142 WP_010953008.1.31851 WP_010953008.1.41 WP_010953008.1.42045 WP_010953008.1.47320 WP_010953008.1.48025 WP_010953008.1.58218 WP_010953008.1.71439 WP_010953008.1.87606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]