SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160488.PP_3183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_3183
Domain Number 1 Region: 41-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.69e-33
Family Glutathione peroxidase-like 0.0014
Further Details:      
 
Domain Number 2 Region: 214-311
Classification Level Classification E-value
Superfamily Cytochrome c 2.23e-16
Family monodomain cytochrome c 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_3183
Sequence length 327
Comment (Pseudomonas putida KT2440)
Sequence
MPGSWRFLLVLALFAASIPFWPLQPQRTVAEAAASPWGASYFPNIPLLTQDGEKVHFFDD
LIKDKVVAINFIFTGCSDSCPVETARLRQVQKILGDRVGKDIFLYSISIDPYNDTPATLK
RYAEKFGIGPGWTLLTGEPDDIEQLRRSLGLWIDGLENGRSKDHNLSLIIGNQATGRWMK
ASPFESPYILADRLGNSLHNWKQASAMSNDYAQAPQIRSPSSGEQIFRTRCSSCHTVGNT
EPGQPGIGPDLLGVTRQRDANWLVRWLKVPDQMLAEKDPLAMLLFEQYNRLAMPNMRLGD
AEVSALISYLEEETARLQTPVTNRGIP
Download sequence
Identical sequences Q88I19
160488.PP_3183 gi|26989902|ref|NP_745327.1| NP_745327.1.35174 WP_010954068.1.28295 WP_010954068.1.28475 WP_010954068.1.3142 WP_010954068.1.58218 WP_010954068.1.71439 WP_010954068.1.87606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]