SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160490.SPy_1633 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160490.SPy_1633
Domain Number 1 Region: 336-485
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.98e-27
Family HD domain 0.028
Further Details:      
 
Domain Number 2 Region: 223-319
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.07e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 160490.SPy_1633
Sequence length 535
Comment (Streptococcus pyogenes M1 GAS)
Sequence
MVNIILLIVSALIGLILGYALISIRLKSAKEAAELTLLNAEQEAVDIRGKAEVDAEHIKK
TAKRESKANRKELLLEAKEEARKYREEIEQEFKSERQELKQLETRLAERSLTLDRKDENL
SSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKKAELEKVAAMTIAEAREVILMETEN
KLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQTITSVHLPDDNMKGRI
IGREGRNIRTLESLTGIDVIIDDTPEVVILSGFDPIRREIARMTLESLIADGRIHPARIE
ELVEKNRLEMDNRIREYGEAAAYEIGAPNLHPDLIKIMGRLQFRTSFGQNVLRHSVEVGK
LAGILAGELGENVALARRAGFLHDMGKAIDREVEGSHVEIGMEFARKYKEHPVVVNTIAS
HHGDVEPDSVIAVLVAAADALSSARPGARNESMENYIKRLRDLEEIATSFDGVQNSFALQ
AGREIRIMVQPEKISDDQVVILSHKVREKIENNLDYPGNIKVTVIREMRAVDYAK
Download sequence
Identical sequences A0A0E1ELN4 A0A0H3BY61 A0A2H1X7B0 A2RD66 J7M684 P0DF20 P0DF21 P67284 Q1J5I5 Q1JAJ3 Q1JKP5 Q48S17 Q5XAP0
gi|94988967|ref|YP_597068.1| gi|28895398|ref|NP_801748.1| gi|71911155|ref|YP_282705.1| DR65 gi|410681005|ref|YP_006933407.1| gi|139473320|ref|YP_001128035.1| gi|470201505|ref|YP_007587934.1| gi|94994847|ref|YP_602945.1| gi|94992860|ref|YP_600959.1| gi|21910912|ref|NP_665180.1| NP_269682.1.14755 WP_002988954.1.100536 WP_002988954.1.100577 WP_002988954.1.100847 WP_002988954.1.100902 WP_002988954.1.101138 WP_002988954.1.102005 WP_002988954.1.1042 WP_002988954.1.11114 WP_002988954.1.11468 WP_002988954.1.11642 WP_002988954.1.11796 WP_002988954.1.1208 WP_002988954.1.12667 WP_002988954.1.12676 WP_002988954.1.13094 WP_002988954.1.134 WP_002988954.1.13499 WP_002988954.1.13655 WP_002988954.1.13702 WP_002988954.1.13723 WP_002988954.1.13803 WP_002988954.1.14556 WP_002988954.1.15156 WP_002988954.1.1526 WP_002988954.1.15301 WP_002988954.1.15867 WP_002988954.1.16107 WP_002988954.1.16883 WP_002988954.1.17594 WP_002988954.1.17618 WP_002988954.1.19566 WP_002988954.1.19969 WP_002988954.1.19971 WP_002988954.1.20146 WP_002988954.1.20187 WP_002988954.1.20282 WP_002988954.1.2074 WP_002988954.1.20768 WP_002988954.1.20957 WP_002988954.1.21068 WP_002988954.1.21420 WP_002988954.1.22005 WP_002988954.1.22309 WP_002988954.1.22587 WP_002988954.1.22610 WP_002988954.1.2271 WP_002988954.1.22927 WP_002988954.1.23366 WP_002988954.1.23854 WP_002988954.1.23879 WP_002988954.1.24256 WP_002988954.1.24700 WP_002988954.1.24771 WP_002988954.1.25243 WP_002988954.1.26201 WP_002988954.1.2644 WP_002988954.1.26529 WP_002988954.1.26775 WP_002988954.1.26802 WP_002988954.1.26942 WP_002988954.1.27012 WP_002988954.1.27096 WP_002988954.1.27102 WP_002988954.1.2743 WP_002988954.1.27781 WP_002988954.1.27947 WP_002988954.1.28087 WP_002988954.1.28592 WP_002988954.1.29586 WP_002988954.1.29629 WP_002988954.1.30259 WP_002988954.1.30461 WP_002988954.1.31038 WP_002988954.1.31126 WP_002988954.1.32327 WP_002988954.1.33081 WP_002988954.1.34145 WP_002988954.1.34147 WP_002988954.1.34154 WP_002988954.1.34661 WP_002988954.1.34964 WP_002988954.1.35339 WP_002988954.1.35416 WP_002988954.1.35535 WP_002988954.1.35765 WP_002988954.1.3577 WP_002988954.1.35803 WP_002988954.1.36083 WP_002988954.1.37580 WP_002988954.1.3764 WP_002988954.1.38004 WP_002988954.1.39245 WP_002988954.1.39774 WP_002988954.1.39950 WP_002988954.1.4028 WP_002988954.1.4053 WP_002988954.1.41087 WP_002988954.1.41146 WP_002988954.1.41304 WP_002988954.1.41398 WP_002988954.1.41814 WP_002988954.1.42026 WP_002988954.1.42545 WP_002988954.1.43805 WP_002988954.1.44357 WP_002988954.1.45044 WP_002988954.1.45784 WP_002988954.1.45887 WP_002988954.1.46237 WP_002988954.1.46364 WP_002988954.1.46419 WP_002988954.1.47538 WP_002988954.1.47933 WP_002988954.1.49019 WP_002988954.1.49308 WP_002988954.1.51065 WP_002988954.1.51625 WP_002988954.1.51729 WP_002988954.1.52414 WP_002988954.1.52458 WP_002988954.1.5255 WP_002988954.1.5275 WP_002988954.1.52963 WP_002988954.1.53322 WP_002988954.1.53400 WP_002988954.1.53936 WP_002988954.1.54255 WP_002988954.1.55020 WP_002988954.1.55040 WP_002988954.1.55521 WP_002988954.1.56127 WP_002988954.1.56455 WP_002988954.1.56879 WP_002988954.1.57070 WP_002988954.1.57973 WP_002988954.1.58073 WP_002988954.1.58327 WP_002988954.1.58465 WP_002988954.1.59139 WP_002988954.1.59543 WP_002988954.1.5959 WP_002988954.1.59712 WP_002988954.1.59971 WP_002988954.1.60378 WP_002988954.1.60435 WP_002988954.1.60446 WP_002988954.1.61127 WP_002988954.1.61350 WP_002988954.1.62083 WP_002988954.1.62427 WP_002988954.1.62548 WP_002988954.1.62966 WP_002988954.1.6385 WP_002988954.1.64314 WP_002988954.1.64903 WP_002988954.1.65209 WP_002988954.1.65801 WP_002988954.1.65831 WP_002988954.1.6624 WP_002988954.1.66344 WP_002988954.1.66918 WP_002988954.1.67715 WP_002988954.1.67764 WP_002988954.1.68080 WP_002988954.1.68191 WP_002988954.1.68302 WP_002988954.1.68539 WP_002988954.1.69171 WP_002988954.1.69206 WP_002988954.1.69338 WP_002988954.1.69536 WP_002988954.1.69602 WP_002988954.1.70332 WP_002988954.1.70768 WP_002988954.1.71274 WP_002988954.1.71714 WP_002988954.1.72175 WP_002988954.1.72435 WP_002988954.1.72664 WP_002988954.1.72799 WP_002988954.1.7367 WP_002988954.1.74272 WP_002988954.1.74376 WP_002988954.1.74388 WP_002988954.1.74440 WP_002988954.1.74742 WP_002988954.1.74766 WP_002988954.1.74773 WP_002988954.1.75067 WP_002988954.1.75380 WP_002988954.1.75397 WP_002988954.1.75746 WP_002988954.1.75979 WP_002988954.1.77086 WP_002988954.1.77451 WP_002988954.1.77464 WP_002988954.1.77602 WP_002988954.1.77721 WP_002988954.1.7902 WP_002988954.1.7969 WP_002988954.1.80116 WP_002988954.1.80549 WP_002988954.1.8063 WP_002988954.1.80675 WP_002988954.1.81017 WP_002988954.1.81317 WP_002988954.1.81523 WP_002988954.1.82325 WP_002988954.1.8309 WP_002988954.1.83533 WP_002988954.1.83949 WP_002988954.1.83959 WP_002988954.1.8445 WP_002988954.1.84495 WP_002988954.1.84548 WP_002988954.1.84888 WP_002988954.1.85790 WP_002988954.1.86460 WP_002988954.1.86569 WP_002988954.1.86840 WP_002988954.1.87115 WP_002988954.1.87245 WP_002988954.1.87367 WP_002988954.1.87861 WP_002988954.1.8796 WP_002988954.1.88255 WP_002988954.1.88297 WP_002988954.1.88361 WP_002988954.1.88809 WP_002988954.1.88958 WP_002988954.1.89166 WP_002988954.1.89339 WP_002988954.1.89421 WP_002988954.1.89609 WP_002988954.1.89617 WP_002988954.1.91031 WP_002988954.1.91222 WP_002988954.1.92241 WP_002988954.1.92390 WP_002988954.1.92885 WP_002988954.1.93188 WP_002988954.1.93335 WP_002988954.1.93887 WP_002988954.1.93979 WP_002988954.1.94658 WP_002988954.1.94718 WP_002988954.1.94743 WP_002988954.1.94792 WP_002988954.1.94988 WP_002988954.1.95191 WP_002988954.1.95380 WP_002988954.1.95717 WP_002988954.1.96175 WP_002988954.1.96236 WP_002988954.1.96338 WP_002988954.1.96528 WP_002988954.1.96685 WP_002988954.1.96787 WP_002988954.1.97076 WP_002988954.1.97489 WP_002988954.1.97674 WP_002988954.1.9843 WP_002988954.1.98562 WP_002988954.1.98938 WP_002988954.1.9914 WP_002988954.1.99282 WP_002988954.1.99582 WP_002988954.1.99639 WP_002988954.1.99902 WP_002988954.1.99981 gi|209559772|ref|YP_002286244.1| gi|15675508|ref|NP_269682.1| gi|71904045|ref|YP_280848.1| 160490.SPy_1633 160491.SpyM50449 193567.SPs0486 198466.SpyM3_1376 286636.M6_Spy1388 293653.M5005_Spy_1342 319701.M28_Spy1383 370551.MGAS9429_Spy1337 370553.MGAS2096_Spy1363 370554.MGAS10750_Spy1451 471876.Spy49_1266c gi|50914734|ref|YP_060706.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]