SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160491.SpyM51778 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  160491.SpyM51778
Domain Number - Region: 50-113
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0136
Family Sigma3 domain 0.063
Further Details:      
 
Domain Number - Region: 14-42
Classification Level Classification E-value
Superfamily DEATH domain 0.03
Family DEATH domain, DD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 160491.SpyM51778
Sequence length 127
Comment (Streptococcus pyogenes Manfredo)
Sequence
MSKKNAIRKLKEFHRWQRIANSLDLTYTELYQFDIEYHPTRRKYLEISQECALEELNAIK
YAINQLSKLDYRKILIECYLISEEKTQQDIMEELSRSQSWYYETKKRALLEFVEFYRDGA
LKNNVRL
Download sequence
Identical sequences U2U9F4
gi|139474577|ref|YP_001129293.1| 160491.SpyM51778 WP_011889235.1.24700 WP_011889235.1.39245 WP_011889235.1.59971 WP_011889235.1.89166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]