SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160492.XF1174 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160492.XF1174
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily Translational machinery components 2.55e-45
Family Ribosomal protein L18 and S11 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 160492.XF1174
Sequence length 130
Comment (Xylella fastidiosa)
Sequence
MAKQSVVKIKKKVKRVITDGVAHISASFNNTIVTITDRQGNSLFWCTSGASGFRGSRKCT
PFAAQVAAEKAGRAVLDYGMKSLEVRINGPGPGRESAVRSLNNVGYKITNIIDVTPIPHN
GCRPPKKRRV
Download sequence
Identical sequences A0A1L2B2F9 A0A1S0V5D7 Q9PE54
gi|15837776|ref|NP_298464.1| WP_010893687.1.14431 WP_010893687.1.27993 WP_010893687.1.3 WP_010893687.1.3250 WP_010893687.1.3794 WP_010893687.1.41917 WP_010893687.1.4338 WP_010893687.1.45907 WP_010893687.1.50395 WP_010893687.1.57220 WP_010893687.1.58312 WP_010893687.1.64904 WP_010893687.1.72049 WP_010893687.1.82282 WP_010893687.1.82778 WP_010893687.1.92333 WP_010893687.1.94175 160492.XF1174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]