SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160492.XF1478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160492.XF1478
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SET domain 2.88e-35
Family Histone lysine methyltransferases 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 160492.XF1478
Sequence length 139
Comment (Xylella fastidiosa)
Sequence
MFAVVSIHQGERIIEYKGRIRTHAAVDANSHGHIESGHTFLFTLNDDYVIDANDAGNIAR
WINHSCSPNCEAVVEEDTGGNRRKDKIFIQAIRDIASGEELTYNYGIVLAERHTARLKKI
WACLCGSDHCTHTMLQPKR
Download sequence
Identical sequences Q87DI7 Q9PDA1
160492.XF1478 183190.PD0695 XfR170 gi|15838079|ref|NP_298767.1| gi|28198603|ref|NP_778917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]