SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00002243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00002243
Domain Number 1 Region: 22-238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-77
Family Xylanase/endoglucanase 11/12 0.00000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00002243
Sequence length 239
Comment (Aspergillus nidulans)
Sequence
MKLLALSLASLASAATITRRADFCGQWDTATAGNFIVYNNLWGQDNADSGSQCTGVDSAN
GNSVSWHTTWSWSGGSSSVKSYANAAYQFTATQLSSLSSIPSTWEWQYSTTDVVANVAYD
LFTSSSIGGDSEYEIMIWLAALGGAGPISSTGSSIATVTLGGVTWNLYSGPNGSMQVYSF
VASSTTESFSADLMDFINYLVENQGLSNSQYLTHVQAGTEPFTGSDATLTVSSYSVSVS
Download sequence
Identical sequences Q5BG78
ANID_00452T0 162425.CADANIAP00002243 XP_658056.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]