SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00002284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00002284
Domain Number 1 Region: 553-878
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.31e-27
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00002284
Sequence length 981
Comment (Aspergillus nidulans)
Sequence
MSSLFLYEASTPCPGAKGARASNESGNGSDPMRDLWDEDLGNYDDTRNIEFTTEIRAPIL
GAKPKRRTRTTTSFSIHSDYDEKPQATVRSKAGNKSAGIAPANRKTSLLAQPAQRFRSRP
RVSFVPSPLKHCQQHDKTEPEKRSTRPDVQKNNELLKRINATSEEVVAKHVLKDARRTTA
FLPPEDTTAASVFMGIFSPLKCDVENYTSKVSDVCNSEPRVTKERQAKPSIVTSSGRVPL
KPSSNIVQESCDRADIPGQNGGKENIPPGMNLAGLKGKNFRQMDKPMDDKLNYSNLISSK
PLATRKVNQPVKVHSQSILKASVSTAVGERRTLSIRTKNPATRSCTSSSVLSSKTSVLTA
DSTSRNGLKHLRHEYPLASASITNPAMYNDNWLSHQEVILTQLINGVLNHPAREVSDPSM
LRNELLQLYQGAYFTNLYKRLHASLVYGALSIPKDVLKERRLRQDLGMKRKFIDIWVQTY
DSNALRAALEAVTGRIIPLAKANASSTHKSANGASPHEKALTKKLAKFLDAFLIQNQDMD
RSNSEHDTDDEEALAGTYRRTLLRSMMMVILLDKARTSPKTLLSPCLFLASSPYKSSSAV
LQALTRFLLPSCGNVGKAFAQLNCQLTYEQHPLEEYDFLVSNLAVDLRDGIRLTRLVELL
LYPSSRAAPISDCRWPLSRHLKYPCLSRAVKMSNAKFALEALANTEEGKQLTTDIRAADI
VDGHREKTIALLWGLVSNWGLSELVDIDSLKKEISRLERRSDVEYKDDTLSADDSVENNE
PIKLLGQWASLVAQLRGLALNNLTTDMANGKVYECILDEYEGYIYSQSTFTEVRASLRDR
LRALGCSEQFIKIISPGLEARILDTPSTTGALAYLCSCLLPIAKRARAATVIQSAWRRML
DRREAEKRAMARDIAQQCAAVVQTRDRILWAKSVIVHWWRLNRARRRRRRIIVASAKSTT
MKRQSRIPGKTSTKIPLRCVK
Download sequence
Identical sequences A0A1U8QGW3 Q5BGB6
ANID_00414T0 XP_658018.1.1458 162425.CADANIAP00002284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]