SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00004869 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00004869
Domain Number 1 Region: 16-383
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.59e-72
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000974
Further Details:      
 
Domain Number 2 Region: 458-591
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000435
Family Glycosyl hydrolases family 32 C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00004869
Sequence length 646
Comment (Aspergillus nidulans)
Sequence
MPGAMSTPSKPTAPAFTRWRPKFHLLAPSNWLNDPCGPGYDPCTGRYHLAYQWNPKDNEW
GDICWGRATSCDLVSWEIDPEPCLAPSAPYDSKGIFTGCFQSTNLQGQQDGTLTYFYTSV
KSLPIHYTLPYSNGCETLSIALSRDAGRTWERHAQNPILPGPPAGLQVYGWRDPFVCSWP
SAPESVREAARQVVGEGDVMYGFISGGLVNKTPTVFVYAITRNTLTEWKYVGILLDVGLN
YTLSRWSGDLGVNWEVSNLVTLTNKEGTSRDFLIMGVEGCIPSPDPNRPAARDRRIQRSQ
LWTCIKQNETRGQTQTALMQTSFGGIFDSGLFYAANSFFDPVTQRQVVFGWITEEDLPDT
TRKEQGWSGLVSLPRTLTLQTIHCVKRARSTTSLGDITSVEAVPDEQGTYTVHTLGVELD
PRVEELRKGARVLTREALDLSFNVDEAGTVMAATTSTQSSGCFVPLDTTRWEVDAEIAVG
RKCSRVGMVIFHDEDYTAKTTLFWDPVHETFQVERPRPSNINPDINHAPEVTPHTLFTYT
NPATTTNDNTASEIETEEPLRIHALFDSSVLEVFVNGRTAITTRIYHSGGRTKTDGPKCV
GVQFFADAENAGCDADAHAHSGGGAGGKEAPARLIHATIWDSLACL
Download sequence
Identical sequences C8V6J6
162425.CADANIAP00004869 ANID_03837T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]