SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00005380 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00005380
Domain Number 1 Region: 685-1037
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.4e-96
Family Glycosyl hydrolases family 32 N-terminal domain 0.000000000656
Further Details:      
 
Domain Number 2 Region: 1056-1202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-29
Family Glycosyl hydrolases family 32 C-terminal domain 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00005380
Sequence length 1203
Comment (Aspergillus nidulans)
Sequence
MVGGDHRSLIESIYNAPANLLSVVACSGSAVGQCLSPAKFDILVPTSSRIASTKLPTSAN
TSPTLISSNCYGKTAAKQKMAARPQTAKKSKRDRKKAWKKDPWKGKVADLSHPPYRKAKM
EGKLPGPNPDEHVRPSVPTSNHVARAAQRMKYWPERQRLSPIQSPELDAPTLVNGKELGL
PELNRDAKPALNPVDRIPPTRFPRVYVGDNAPTPRWLIRPVRPVTNHESAHNSSSESGSA
ASGFSSASGSSRLLPLGRLRWEFDPGPAAKHGQDEARLHEYAYRYLQNSLRDPIVREEMR
NMIWNSPYALVVANVEDPLPIPPPPPHFKDQRPSDYAALREAISASNPDDYHFKYPDYAR
PSLAARTYGHQDTYKSRKSSVDSQSSAVSHGSSSTGESSRTRASSSSSISIVHKELSPVY
QHEFDDDTNHYLKRGQKVGFKAKIKTKEKNQTESFLSKPPRRGRGRPTKSDIDFLDVPTL
EELSSAEPPRKKRAGVEKPARDMWRPLSETFSEEEDIITPKAPKITSKNAAKAKMDGAIL
NKRTGGWLVSVYAEYESCLPCWQELISFPTLEDTKSGQIPADYAKHDLGTYLVCAEVAKR
QEQLALGWLSASVIHPHGFLPTRRPGYSEGVIPREYSALLLGSRGQTLRAVSDITKMRAR
TLLLRVSIFSAALALQPSAPGPAPYTEPYRPQYHFTPAQNWINDPNGLLYHNGTYHMFYQ
YNPGGVAHEAMSWGHATSQDLTHWDERPVALTARGFPGKNISEQFFSGSAVYDVDNSSGY
GNGMGTAAPMVAMYTSFYVYGQTLPSGKKVRASQQSQSLAYSLDSGETWTTDDAVNPILL
QPPHPYESQYKEWRDPNVFWHAPTKKWILTTALSDLHKLLIYTSTDLKNWTLASEFGPYN
AVGGVWECPSFFPLPVDNDESNVKWVAIIGLNPGGPPGTVGSGNQYILGQFNGTHFLPDA
ESLHEQGEANWLDYGPDFYAALVYNGLPEFQRTVIAWMSNWQYAEKVPTTVWRNAMTIPR
RLGLKTINGKVLVVQEPEANWAAIMSKPQTTRILSLPANSTRNLGSLGKTLAANLTFSAG
EQNGSSFGISLLATQNFTTQTLIGYNFATKHIFVDRRASGNTSFDETFASVYRAPLEPAD
DGTVTLRIFADWSSVEVFGGQGETTLTAQVFPPEGATHARLFANGAGVEDVLLSVSKVGS
VWN
Download sequence
Identical sequences A0A1U8QV23 Q5B368
XP_662616.1.1458 162425.CADANIAP00005380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]