SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00005927 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00005927
Domain Number 1 Region: 63-301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.52e-54
Family Glycosyl hydrolases family 16 0.00065
Further Details:      
 
Weak hits

Sequence:  162425.CADANIAP00005927
Domain Number - Region: 36-62
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0288
Family Hevein-like agglutinin (lectin) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00005927
Sequence length 435
Comment (Aspergillus nidulans)
Sequence
MLRLQTALFFAYLAARSLAADDFTPPSCSLDEHCPKEYPCCSVYGQCGTGAYCLGGCDPL
MSYSLDSCAPMPVCESKSYKWENLDSAASNNEYLGNATESDWVYSGKLKVEDGNLVLTMP
KESTGSLIANNHYIWYGKIGAKIKSSRGAGVVTAFILLSDTKDEIDYEWVGSDLKEVQTN
YYFQGILDYDNGGKSKVDGGNTYADWHTYEIDWTPEKIDWLVDGEVVRTLTKESTFNETA
DRYEYPQTPSRMQLSLWPAGQASNAQGTIEWAGGEIDWDSEDIKNQGYYAAYYSDITVEC
YDPPSDAKVSGDVSYDFKDDKGLESSVEITDNNTVLASLGATGLNMDLGSNKTDSSGNST
GSISNSTVPQNQGGTGNIAGSSTGNGGSSSSDSSGGAFSQGTDDSTDGENAAPSERVLKG
SFFAVLVAVVVLIIM
Download sequence
Identical sequences A0A1U8QLD2 Q5B4L5
162425.CADANIAP00005927 ANID_04515T0 XP_662119.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]