SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00006660 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00006660
Domain Number 1 Region: 267-364
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000213
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 
Domain Number 2 Region: 570-621
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 
Domain Number 3 Region: 641-725
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  162425.CADANIAP00006660
Domain Number - Region: 502-556
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00006660
Sequence length 1003
Comment (Aspergillus nidulans)
Sequence
MHKITNFTGQARHGWERMTPTFGMSRPHAELASHSLRRPHGAPPMTPPTGIDPTVNLSFN
VPFSSTLAGPDVDDVLHASPKALQRWSFPEGTPEGTPIHQLPVHTSNVEALRILCRQITE
SSNGRVEALVSSSEPKTVPSLQRRPQRLATNVCITGDGETVRKMRAKILNDTPILLRCAT
VDVDTHLITDNQTKEVRPPVLEHLDTLAAYTGTDIFLLTPKLRDNDSAVVSSYGYATDNG
LDQRFRVCIYGDMESTEHAKTRVLIMIDQILKRHVDAVKLDLTTHTLVCGRTRKNIKLIE
AATGTAIYFPPPFPRIFGYIPPGAHRRSEDEVYITGETQEQIARAKQKLHELVMGVKVYV
KDVVVNSNKIDNILLDRLDKVRKVMEMNGSYVLFPQLGSQRGIVRIQGTDVLHVERTVRE
IMALAGQFYSASWWILVPDPTPGAVRTPTHAEVRTMLSDICTNSGAEVSFDNLNFTINGS
DDAVKAAMTVINQIPFVQRSQYQMRVKIELANEHKEFVSGKKNGKINKIMGQSNVQIIFD
GFNEYNFYIDVCGNQFESTKSGLDLVEQEMPASISFHVPDQYHKRIIGIGGQHIQRIMKK
YSVFVKFSNAMDRGGMGKDDDDIKVDNVICRTPARNAQSLDLVKQEIMDMVEKVDAEYVS
ERVVINRLYHRELLARMPEIDELEKKWNCKIEFPSTELASDVVTISGPEYQVPQAVDALL
GMVPESHELLFQSSPELREFFRGADFREDVCAKLKDQYEVDTTVDIPDVQATENGSDSPA
FPPEDRVILGYTRNNAGGLKDAIDFLISRLVAHGLDATTVKGAIPRPKSDSFEESLPFFD
SKLLQHAPTPIATDSPTRPSFTDETSERGSIFERLRKPGSISSFSSFIGRKNHSASPASF
FKHASSNASKASLVSMESRDSGYRNPWNDSGVNLPEDDLPALGSSHSHSSSNGWPARFDT
KFPFGTAPGDMTPKHELRASFDSGRPSTSNSTSGYPAPIGPPR
Download sequence
Identical sequences C8V115
ANID_10807T0 162425.CADANIAP00006660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]