SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00006682 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00006682
Domain Number 1 Region: 33-260
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-66
Family Lectin leg-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00006682
Sequence length 360
Comment (Aspergillus nidulans)
Sequence
MLLPRFSTLLCLAGLTAVPAVNAYDGDENVKSIPLRTHSLSAPYLDSDFQSRWFDFGGDT
VIRADKYIRLTSDRPSQQGWIFSRVPLTATNWEIEFEFQIHGEGNLHGDGFAMWLTKQRA
TQGPVFGSTDNFEGLGIFFDTYKNNRPGTSFPYVMAMMGDGKTSYDQAHDGKANELAGCS
ARGLRTTSVPTKARLTYFQDKSLTLDLQYKSEGTWTNCFTLTSPETNIAIPSVAYLGFSA
ETGELSDNHDIISVKAQNLYNVAGSKGTGGSGPPRSADRPYRKPKKQSGSWSWFLFKVFF
FFAAVRGGYDWMDRLPVQDKVFSVLDERVVDFCGLMRSGPMSESEMVKIKTLSVILYLLA
Download sequence
Identical sequences A0A1U8QK31 Q5AZH3
XP_663911.1.1458 162425.CADANIAP00006682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]