SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00006754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00006754
Domain Number 1 Region: 67-117,153-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000531
Family Single strand DNA-binding domain, SSB 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00006754
Sequence length 300
Comment (Aspergillus nidulans)
Sequence
MATSDTTSNWSYKNKDRSNNNNNASKQKPKLPFYPAFCFRASPTHFAWIKMGAADVHRLT
RRLEYGERGLFFYQNHPIRFVNLVGIIVARADVPRRTILTLDDSTGATVDIVVLKRDPCP
IPVAATVESKPKNNTDVHGEDGAQKEMHLTSTTQTPIDITPLQPGKLFQIKGTLSTFRST
NQVQLERFFPVPDTKTEMRFVEARMRFLAEVLTVPWALDEGDIENLRMQADEEGSRIDDE
QARHRRRARKRAEREERERRRILKLWEQEEVVREREGKIAREAGRDYMLELERRNRLLSS
Download sequence
Identical sequences A0A1U8QTI6 Q5AZP0
ANID_06240T0 XP_663844.1.1458 162425.CADANIAP00006754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]