SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00008086 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00008086
Domain Number 1 Region: 189-273
Classification Level Classification E-value
Superfamily HSC20 (HSCB), C-terminal oligomerisation domain 4.84e-19
Family HSC20 (HSCB), C-terminal oligomerisation domain 0.0072
Further Details:      
 
Domain Number 2 Region: 111-169
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000000126
Family Chaperone J-domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00008086
Sequence length 279
Comment (Aspergillus nidulans)
Sequence
MATSLRAQRAFQRLTVSSTVQSQARPIHTTTRKLSTPTACFLCRLRPSRPNRRTSAIFPS
ALFAQRTFTSTPSTLNSASSETLPVPNAPDTTNYYTIFPQTLPNGPPPSSPFTIDVQALR
REFFSLQNTLHPDKYPPGPTKTAAESLSAIINEAYRTLSDPLLRAQYLLREFHGIDVTAE
DGSGAGAQPLDPELLMEVMDVQEAIEEVGEGQEAVEKIAVMKKENDERVKGCVQALAEAF
DKGDVEGARGECVRLKFWVSVADGLREWEPGMGGIRLIH
Download sequence
Identical sequences A0A1U8QL86 Q5BDB1
ANID_01469T0 162425.CADANIAP00008086 XP_659073.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]