SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00008268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00008268
Domain Number 1 Region: 119-187
Classification Level Classification E-value
Superfamily CSL zinc finger 0.00000000000000127
Family CSL zinc finger 0.0012
Further Details:      
 
Domain Number 2 Region: 8-98
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000000000916
Family Chaperone J-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00008268
Sequence length 188
Comment (Aspergillus nidulans)
Sequence
MTQTSAAPTTTPSFYEILNLPFPSTGLSKQQLKIAYHKALLKHHPDKAVAVAKENLPSSN
HGPAQPPSNQKITIDAITTAYKTLSDPVQRAEYDRVLRLDRNRVNGAGDKNGNGTVFHTG
LEVVDLEDLDCDEGGDEAMWYMACRCGDERGFSLSESDLEREADSGEIVVGCRGCSLYTK
VLFAVQDD
Download sequence
Identical sequences P0C0V5
162425.CADANIAP00008268 ANID_10224T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]