SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00008738 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00008738
Domain Number 1 Region: 1033-1113
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 883-990
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.92e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 3 Region: 215-309
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000349
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 4 Region: 1235-1297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000774
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 713-787
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 6 Region: 302-406
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 7 Region: 780-877
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 8 Region: 389-459
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00008738
Sequence length 1305
Comment (Aspergillus nidulans)
Sequence
MSAEAVNGAPKSRAAMLEEQHALDEAHKATVEDVVDEEDLLHPPPSVQAVSEQASSAPSQ
ASTPPVAKASVSSKNASGKPPALDVQSEELFPALGSGPKPKAPAASAWAAKGPSAAAALA
NGAPSGVSSADVPRIMTLPGKHIEQLRLAPSQMLQRGQLKKPLRDILRDISKRSKANVDM
RGGPGGSIIFEGRGSVDAVRQALKQVAQQVGSKQSVRVPIPTSARPHIIGKQGAVVQELQ
QRTGARVQVPRAEEPTGDEDEDNDTIDVLIEGDAVAAEMARREIEAIVKERASNMNLRLR
SIPPEFFPFIAGPHNANLREIEERTKAQIHVPRYDTWQSQPPPQEAEPGHVQFTPVSDRH
ILISGERSATQDARAEIEKLAADLQRQLTIRQLAINRGQHQFILGDNANALHDFLAETGC
AVVLPPPSDETEFLTVTGPLQRIEDGVNRAMDLATSMQMASIDLSRQHPNAPLGPHAHAR
ALTRYLAQRQIIKELEGMYDSRIALSPASDGPVTWEVYSRDGKNTIRARSDILNLVQAHP
PARLRHLSVDPYFHPYLRSRSIPQLRSNYGVHVLIPDDIDSPDVVLIYEGPSASSSQLEI
PRQRPSAADLATFEKALQEAQEYLLNSLGSQDDIITENVSIPSKYQEKVRKFISREQEAK
GEDHIPVRALVGGGPSRNGGATPQSDVALRGPSRLVKEIAAKIGEFVVEQEKDDLERGYT
TSFDFPKKFANFLIGKRGENINKLRDEFDVDIKVEDGKVEVKGPKAKADAAKARIINLGK
KLEDETTHVLKVPAQYHRELIGQKGSQVNRLQDRYSVRVQFPRAVVINDDQSVADTASEA
GSARPQRSQQASDEVIVKGPSKGADAARDEILSLLQWVVDHSHTATVSVAQGQIPSLIGQ
RGREMDKLRADTGAQIDVPGANDAPDTSGRVEIKIKGTKKQVEEAKKILQQRSSEFDATV
TKTINVDKKHHKSLIGGGGANIRKLVAEAGGPTDSSASRLVRFPRPESDDTTIRLEGNGA
IVDKIIAAIEQFVQEREDQVAINLEVPPVQHRLLIGRGGDTRRGIESQFGVTLDIPRQGS
GRSDVKLKGPSNAVEQAKEHILAMLKDQQGVNVDVPSHLHHAIADNGSFFRRLRNDYQVT
VDHAGQQIPPRPNVEDSRSAVNGASSLPLITDEPSDALDAHSWKVVDNNVASDPSQPATI
PWVLAGSTDNVNKAKAALEKAIAAASQQSATGYLILPDPKTYRFVVGQGGSQINSIRKQT
GCRINVPKDQAKGEAIEIKGSKENLDKARDLILEAVRAGLNGNSR
Download sequence
Identical sequences A0A1U8QMN4 Q5BBL2
XP_659672.1.1458 ANID_02068T0 162425.CADANIAP00008738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]