SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00008760 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00008760
Domain Number 1 Region: 385-461
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.38e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00029
Further Details:      
 
Domain Number 2 Region: 102-179
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000669
Family Eukaryotic type KH-domain (KH-domain type I) 0.00081
Further Details:      
 
Domain Number 3 Region: 188-263
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00008760
Sequence length 465
Comment (Aspergillus nidulans)
Sequence
MSASPSALQSTKRPLEDPSSPSGPNDQPEAKRPALDKVVKGEESENNAEVKTESGAANDA
DGQGDTVVPDAPKGGVSETQPIQSTASHGEAAGNQSEQQRPQDESNWIHIRAVISSQEAA
TVIGKGGENVSQIRRLSGAKCTVSDYSRGAVERILTVSGPQDAVAKAFGLIIRTLNNEPL
DAASTAQSKTYPLRLLIPHILIGSIIGKGGTRIREIQDASGARLNASDACLPLSTERSLV
ILGVADAVHIATYYVAVTLVEQLTERFGGPAASAYATRSGGPAGAVPGGMQVVPYVPQPA
GGQYGHPDTFKRHHPGQARAGAGAYGVPYLHGQHAPAPVAPQPMHYGAPQTPYAGAGPHQ
PTPYGAPQAAQPRGGPTPAAPVGGAMPGQPLTQQIYIPNDMVGAIIGKGGAKINEIRHLS
GSVIKINEPQENSNERLVTITGTQECNQMALYMLYSRLESEKHRI
Download sequence
Identical sequences C8VLW6
162425.CADANIAP00008760 ANID_10257T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]