SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00009613 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00009613
Domain Number 1 Region: 211-373
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.45e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 2 Region: 117-209
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.2e-24
Family Cold shock DNA-binding domain-like 0.0000659
Further Details:      
 
Domain Number 3 Region: 58-117
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000034
Family ECR1 N-terminal domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00009613
Sequence length 390
Comment (Aspergillus nidulans)
Sequence
MAITILAPVADDVDATYAESDFDDMSVDSDGGVELTPAKSSRPTKRPRLIEGVDIGTGII
TPGEVVTNDPQWMRLTSSLSSRGHGTYTNPLSTSIIATVAGTVQKTNKLLSVQPLRARYT
PEIGDLVVGRIVEVQSRRWKVDVAAPLLAQLPLSAINLPGGILRRRTSADELQIRTFFSE
GDLLVAEVQTVHSDGAASLHTRSLKYGKLRNGVFLAVAGTGGSGASSSSTKGGLGSGSAT
GVVRSRRQMFTITTSNGGGDVDLVLGVNGYIWISKHVEGTAAASSATEHVSITRMEEMVS
NSVYSSQNDEISPATRREIARLTQCIRVLVQGGLRVDEETVTAAYDASLQVDLEQGDDYD
EDGRQREGREYLEGTQAKRIIQLVTAQQSR
Download sequence
Identical sequences C8VHJ5
162425.CADANIAP00009613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]