SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00009815 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  162425.CADANIAP00009815
Domain Number - Region: 74-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000739
Family Galectin (animal S-lectin) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00009815
Sequence length 198
Comment (Aspergillus nidulans)
Sequence
MASNHELPEYPHDEALVRRHVSLSAMESPHSHSARYNARTKTLVEQSGVQAAAYYSQGVA
EYNRFMASGDTLNIKLGAVWSGFRDDPRDHNSLSLWDEHGHISLHVAFNRYDRTIRINTW
DGQWGNEIYTSFPDSIVQEVHTTIAIQYWAPGSYTIHIGGMGLDVDVPRLSAPNALTYRV
SRNNDGMFGGKVDTTLNY
Download sequence
Identical sequences A0A1U8QS08 Q5B884
XP_660850.1.1458 162425.CADANIAP00009815 ANID_03246T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]