SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00010228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00010228
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.5e-39
Family Calponin-homology domain, CH-domain 0.0000258
Further Details:      
 
Domain Number 2 Region: 164-231
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.98e-17
Family EB1 dimerisation domain-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00010228
Sequence length 246
Comment (Aspergillus nidulans)
Sequence
MGESRQELLAWLNNLLQLNMTKIEQCGTGAALCQIFDSIFMDVPMSRVKFNVNTEYAYLQ
NFKILQNVFARHQIDKPIPVESLSKCRMQDNLEFLQWTKKYWDQHYPGGDYDALARRKAS
GAPPGSAGTSRAGATSASSARRGTTPTVGRARPAAGGASSATVAALQAELNSTKEAISGL
EKERDFYFAKLRDIELLLQNAIEADPELEKDDDSLVKHIQGILYSTEEGFEIPAEGEVAG
DELETF
Download sequence
Identical sequences A0A1U8QRT5 Q5B9B8
ANID_02862T0 162425.CADANIAP00010228 XP_660466.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]