SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 163164.WD0906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  163164.WD0906
Domain Number 1 Region: 291-483
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-47
Family Ribonuclease PH domain 1-like 0.0000342
Further Details:      
 
Domain Number 2 Region: 2-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-46
Family Ribonuclease PH domain 1-like 0.0000748
Further Details:      
 
Domain Number 3 Region: 446-544
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.58e-27
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 137-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.68e-20
Family Ribonuclease PH domain 2-like 0.0065
Further Details:      
 
Domain Number 5 Region: 551-629
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 
Domain Number 6 Region: 605-690
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000566
Family Cold shock DNA-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 163164.WD0906
Sequence length 757
Comment (Wolbachia endosymbiont of Drosophila melanogaster)
Sequence
MFKIIKKSIEWGGRALSLETGKIARQAHGSVVVNYGDTSVLVTVVRKKKEESVDFLPLNV
QFIAKSYAMGKIPGGFFKREGKPSDRETLISRVIDRSIRPLFPEGFHDEISVVCNLLTYD
TVNPPEVPALIGAVAALAISGVPFHFTIAGVMVGCDENNNYILNPSVQEMKASSLDLFLS
GDENSILMVESEVKELSEENVFNAIKFGHEHLKPVIKLIKEFADTIGNKPESFAPIDASD
ITQELEKYGKDFEKAYSQTVKQERVQALEAIRENILNTLKETGKDEKLITYAVKNFERSL
VREIIRKKSVRIDGRKHDEIRQIEVEVDILSKTHGSALFTRGNTQALVVTALGTTQDEQI
VDDIEGDRREHFMLHYNFPSFAVGETSAARAPGRREIGHGKLAWKAIHPVLPDKSEFPYT
IRVVSEILESDGSSSMATVCGTSLALMDTGVPIKAPVAGIAMGLIKDKDEYVILSDILGD
EDYLGDMDFKVAGTSEGVTALQMDMKISGISFEIVEKSLEQAKAGRLHILEKMNAVISEH
SDDVKDHAPRMLSFYIDKDKISAAIGSKGKNIRSVCERSNAKIEIGDDGKVSVFATSGTE
AEIAKSMMIDSITELEQGSIVDVKVVRIEKSIVELEFLNGRKGKMHISEVANEHIDSIES
VLKQDDTFKALVIDFEKGGCPKLSRRRVDQETGEFFEGELYNEERKDGPNDRDNYYNNSF
SRKPGGSHHKRPPRPHSGFSNRNRPKFGNNDSSSGFY
Download sequence
Identical sequences Q73GN4
gi|42520733|ref|NP_966648.1| 163164.WD0906 WP_010962918.1.65598 WP_010962918.1.78080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]