SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI45555 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI45555
Domain Number 1 Region: 13-199
Classification Level Classification E-value
Superfamily Macro domain-like 4.04e-46
Family Macro domain 0.0000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI45555
Sequence length 200
Comment (Phytophthora ramorum)
Sequence
LPHSSKDARGFEQIALWKGDITTLKTTAIVNAANSALLGCFQPTHKCIDNVIHCMAGPRL
RAACHDIMSRQAHEESTGNAQITPGFALPAQYVLHTVGPQLRRGSKPSGAERDQLQSCYT
KSLDLLLETVSSSKQEENVSVAFPCISTGLFAFPSDEAVPIAVDSVLEWLATHEDETRGW
KVVFNTFLKKDYDLYKTYIE
Download sequence
Identical sequences H3G6D3
164328.JGI45555 jgi|Phyra1_1|45555|gwEuk.25.24.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]