SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI47906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI47906
Domain Number 1 Region: 135-243
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 9.16e-40
Family P-domain of calnexin/calreticulin 0.0000077
Further Details:      
 
Domain Number 2 Region: 2-138,247-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-36
Family Calnexin/calreticulin 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI47906
Sequence length 312
Comment (Phytophthora ramorum)
Sequence
xRFYALSAKFDKPLDNKGRDLFLSYLVQHEQKLDCGGAYIKLLPADVDQANFGGDSPYAV
MFGPDICGSTKKTHAILNYARPGEDAVNMDHKDTIRTESDTDAHLYSFVLKQDNTYEVKI
DGKSVKEGELVKGWPFQPEKQVQDPNESKPKDWVDAKQMADPEDKKPAGWDDTPKTIPDP
DAEKPEDWDDEDDGEWEPAMIENPEYKGEWKPKMVDNPDYKGEWVHPLIDNPDFFEDDSM
YNIAKNVGAIGFELWQVKSGTLFDDILVTDSEEEFNAHEEAVLAKTEAMQEKKKQIQDEE
KAKKEAEAKAKE
Download sequence
Identical sequences H3G6U6
jgi|Phyra1_1|47906|gwEuk.357.3.1 164328.JGI47906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]