SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI49047 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI49047
Domain Number 1 Region: 2-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.94e-67
Family Xylanase/endoglucanase 11/12 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI49047
Sequence length 219
Comment (Phytophthora ramorum)
Sequence
DFCDQWGTATTDDYIIYNNLWGESYATSGSQCTGLDSSSGSAVAWHTNWTWAGASSSVKS
YANAALQFDAVQLSSVSSVPTTMEYSLDYSGTIVADVSYDLFTSSTSDGDNEFEIMIWLA
AIGGAGPISSTGSAVATTTIADTEWSLYSGANGDTTVYSFVASDTVKSFSGDLMDFFTYL
IDNESFSTSQYLNTVQAGTEPFTGTDVTLTVSSFSAVVN
Download sequence
Identical sequences H3G720
164328.JGI49047 jgi|Phyra1_1|49047|gwEuk.44.26.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]