SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI51797 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI51797
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily Flavoproteins 3.15e-60
Family WrbA-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI51797
Sequence length 199
Comment (Phytophthora ramorum)
Sequence
MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP
VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG
GQETTAFTTLTFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE
LDVAKVQGESFAGVAKKLS
Download sequence
Identical sequences H3G7I8
164328.JGI51797 jgi|Phyra1_1|51797|gwEuk.62.126.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]