SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI71281 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI71281
Domain Number 1 Region: 12-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.39e-55
Family Glutathione peroxidase-like 0.00000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI71281
Sequence length 225
Comment (Phytophthora ramorum)
Sequence
MTRNLAGITLLDALPDLPFDASDDSSSSLHSYFRGSWGLLFSHPDDFTPICTTELGEVAQ
LENANEFARRGVTLLALSCNDVASHKRWIVDIEQFSGAKVNFPIVADPSRRIAAKLGMLS
QDDLDSERMPLTVRTLFVLDPQVRVRLMLTYPASTGRNFEEVLRVLDSLQLTDEKNLSTP
VNWKQGGRVCITPQVSMEEAAGKFHDMIVEKLPSDKSYLRFTKEY
Download sequence
Identical sequences H3G8P5
164328.JGI71281 jgi|Phyra1_1|71281|fgenesh1_pm.C_scaffold_11000016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]